KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0532Help
Entry
MGAS1882_0532     CDS       T02062                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase protein TpiA
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGAS1882_0532 (tpiA)
   01230 Biosynthesis of amino acids
    MGAS1882_0532 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS1882_0532 (tpiA)
   00051 Fructose and mannose metabolism
    MGAS1882_0532 (tpiA)
   00562 Inositol phosphate metabolism
    MGAS1882_0532 (tpiA)
Enzymes [BR:stx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MGAS1882_0532 (tpiA)
Exosome [BR:stx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGAS1882_0532 (tpiA)
  Exosomal proteins of bladder cancer cells
   MGAS1882_0532 (tpiA)
  Exosomal proteins of melanoma cells
   MGAS1882_0532 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
495450..496208
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLLSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattactttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgacgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctgatagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system