KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0608Help
Entry
MGAS1882_0608     CDS       T02062                                 

Gene name
murA.1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase protein MurA
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS1882_0608 (murA.1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MGAS1882_0608 (murA.1)
Enzymes [BR:stx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     MGAS1882_0608 (murA.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
583972..585243
Genome map
AA seq 423 aa AA seqDB search
MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRNVPILSDVFTMNNVVR
GLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGVTHLRGVEHDVVQDRIEAG
TFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEEYGIRVQANTPKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLEEMRRMGLQSEILRETAMIHG
GRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHLDRGYYQFHEKLAKLGATISRS
SEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaataatcattgaaggtggtcaaacacgcttagaaggagaagttgttattgag
ggtgctaaaaacgcagttcttcctttactggcagcatctattttaccttcaaaaggaaaa
acaattcttagaaacgttcctattctatctgatgtttttaccatgaataacgtagtacgt
ggtttagatattcgtgttgattttaatgaagcagctaacgaaatcacagttgatgcctca
ggacacattttagatgaagccccttacgagtacgtgagccaaatgcgtgcctctattgtt
gttttaggaccaattttggcacgtaatggccacgcaaaagtatcaatgcctggaggctgt
acgattggcagtaggcctattaatttgcacttaaaaggattagaggctatgggggcaacg
attactcaaaaaggtggagatattactgctcaagcagatcgactgcaaggtgccatgatt
tatatggacttcccatctgtaggagctacccaaaacttgatgatggctgccactttagct
gatggtgtgaccactattgaaaatgctgctcgtgagcctgaaattgttgatttagctcaa
tttttgaataaaatgggagctagaattcgtggtgctggaacagagacgttaacgataaca
ggcgtcacgcatttacgaggcgtagaacatgatgttgttcaagatcgtatagaagccggt
acttttatggttgcagcggcgatgacttcaggcaatgttttgattagagatgctgtttgg
gaacataatcgtccattgatttcaaaattaatggaaatgggtgtttctgtaacagaagaa
gaatacggtattcgcgttcaagcaaacacgccaaagctcaaacctgtaacggttaaaacc
ttgcctcatccaggttttccaacagacatgcaagctcaatttacagctttaatggcagtg
gtcaatggagagtctactatggttgaaactgtctttgaaaatcgatttcaacatctggaa
gaaatgcgacgcatgggcttacaatctgaaatccttagagaaactgccatgattcatggt
ggaagacaactgcaaggtgctcctgtgatgtcaacagatttacgtgccagtgctgccctt
atcttgacagggattgttgctcaaggagttacaatagttaataatttggttcatttagat
cgtggctactatcaatttcatgaaaaattagcaaagcttggagctactattagtcgtagc
agtgaggtctag

DBGET integrated database retrieval system