KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0665Help
Entry
MGAS1882_0665     CDS       T02062                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase protein PyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:stx00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:stx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
644557..645492
Genome map
AA seq 311 aa AA seqDB search
MSVVNNRVALTNLVSMEALTTEEVLGLINRGSEYKAGKVVISDHQKDLVANLFFENSTRT
HKSFEVAEKKLGLTVLDFNADASAVNKGESLYDTVLTMSALGTDICVIRHPEDDYYKELV
ESPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGRFEGLKIAIAGDLTHSRVAKSNMQI
LKRLGAELYFYGPEEWYSEAFNAYGTYIAIDQIIKELDVLMLLRVQHERHDGHQSFSKEG
YHQAFGLTQERYQQLKDSAIIMHPAPVNRDVEIADSLVEAPKARIVSQMANGVFVRMAII
EAILNGRNKNS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgtaaataatcgcgttgcacttactaatttagtttcaatggaagcattaacc
accgaagaagttttaggtcttatcaaccgtggttcagaatacaaggctggtaaggttgtt
atttcggatcatcaaaaggatcttgttgccaatttattctttgaaaactccacccgaacc
cataagtcttttgaagtggctgagaagaaactcggcttgacagttcttgatttcaatgct
gatgcaagtgcggttaacaagggagaaagtttgtatgatactgtgttaaccatgagtgca
cttggaacagacatctgtgtgattcgtcacccagaagatgattattacaaggaattagta
gaaagtccaactattacagcttccattgtcaatggaggagatggttctggacaacacccg
agccaatgtttacttgacttattaaccatctatgaagaatttggacgctttgaaggctta
aagattgcgatcgctggtgacttaactcactctagggtggcaaagtccaacatgcaaatc
ctcaaaagattaggagcagagctttatttctatggacctgaagaatggtattcagaagcc
tttaatgcttacggcacttatattgctattgaccagattattaaggaattggatgttctt
atgttgctgcgtgtacagcacgaacgtcatgacggccatcagagtttttcaaaagaaggt
taccatcaagcgtttggattgacacaggaacgttaccaacaattaaaagattctgctatt
attatgcatccagctccagttaatcgggatgtggaaattgcagatagtttggtggaagct
cctaaagcgagaattgtatctcagatggctaatggtgtctttgttcgcatggctattatt
gaagccattttgaatggtagaaataaaaactcatga

DBGET integrated database retrieval system