KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0710Help
Entry
MGAS1882_0710     CDS       T02062                                 

Gene name
folA
Definition
fihydrofolate reductase protein FolA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS1882_0710 (folA)
   00670 One carbon pool by folate
    MGAS1882_0710 (folA)
Enzymes [BR:stx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MGAS1882_0710 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693554..694051
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGVAGKLPWYLPKELEHFKKTTLHQAILMGRVTFEGMNCKRLPQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQDKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPNLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtgttgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcaatcttaatgggccgtgtgacttttgaaggaatgaattgcaaaagacttcctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggataaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttattttgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgacccaatctagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system