KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_0760Help
Entry
MGAS1882_0760     CDS       T02062                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase RfbC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MGAS1882_0760 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS1882_0760 (rfbC)
Enzymes [BR:stx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MGAS1882_0760 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740057..740650
Genome map
AA seq 197 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQKEKMLPIGFPERFFEEGKL
QNNVSFSRQHVLRGLHAEPWDKYISVADDGKVLGAWVDLREGETFGNVYQTVIDASKGMF
VPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPSLGITWENLAAAEVSEAD
KNHPLLSDVKPLKPKDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaattccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaaaagaaaaaatgttgccaattggctttccagaacgtttttttgaggaaggaaaacta
caaaacaacgtttctttttcacgtcagcatgtgctgcgtggacttcatgctgaaccttgg
gataaatacatctcagttgctgatgatggcaaggttttaggggcttgggttgatcttcgt
gagggagagacttttggaaacgtctaccagacagtgattgatgcttcaaaaggaatgttt
gttcctagaggggttgctaatggctttcaagttctttcagagactgtctcttacagttat
cttgtcaatgactactgggctcttgacttgaaacctaagtatgcttttgtaaactatgct
gacccaagtcttgggattacttgggaaaatctagcagctgcagaagtttctgaagcagat
aagaaccatcctcttcttagtgatgtcaaaccactgaaaccaaaagacctatag

  All links  
No link information was found.   
DBGET integrated database retrieval system