KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1202Help
Entry
MGAS1882_1202     CDS       T02062                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
stx00010  Glycolysis / Gluconeogenesis
stx00052  Galactose metabolism
stx00500  Starch and sucrose metabolism
stx00520  Amino sugar and nucleotide sugar metabolism
stx00521  Streptomycin biosynthesis
stx01100  Metabolic pathways
stx01110  Biosynthesis of secondary metabolites
stx01120  Microbial metabolism in diverse environments
stx01130  Biosynthesis of antibiotics
stx01200  Carbon metabolism
Module
stx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS1882_1202
   00052 Galactose metabolism
    MGAS1882_1202
   00500 Starch and sucrose metabolism
    MGAS1882_1202
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS1882_1202
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS1882_1202
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MGAS1882_1202
Enzymes [BR:stx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MGAS1882_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFC68408
Position
complement(1178618..1179589)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIVASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aagcatattgttcccgatattgtagcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaatcttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgtcggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcctacgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagtaaagacattttcatggcggctgaagcaggggattcctttgctgattctgtt
gtggaaaaggttggctactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system