KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1298Help
Entry
MGAS1882_1298     CDS       T02062                                 

Gene name
gmk
Definition
guanylate kinase protein Gmk
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:stx00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1272348..1272983)
Genome map
AA seq 211 aa AA seqDB search
MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRPQRPGEVDGVDYFFRTRE
EFEELIKTGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKSKVPDGVF
VFLTPPDLDELEDRLVGRGTDSQEVIAQRIERAKEEIALMREYDYAVVNDEVALAAERVK
RIIETEHFRVERVIGRYDKMIKITKNPFKAK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgcggtttgttaatcgtcttttctggcccttcaggtgtcggaaaaggaacg
gtaagacaagaaattttttcaacgccagatcataaatttgaatattcggtttcaatgacg
actcgtccgcaaagaccgggcgaggttgatggggttgattatttcttccgcacacgtgaa
gaatttgaagaactcattaaaactggtcaaatgctagagtatgctgaatatgttggtaat
tactatggcacccctttaacttatgttaatgagactcttgataagggaattgatgtcttt
ttagaaattgaagttcaaggagctcttcaggttaagtcaaaagtaccagatggtgttttt
gtttttttaacaccaccagatttagatgaattagaagaccgcctggttggtcgtggtaca
gatagtcaagaagtcatagctcaacgtattgaaagagcaaaagaagaaattgcccttatg
cgcgaatacgattatgcagttgttaatgatgaagttgccttggcagctgagcgggttaag
cgtatcattgagacagaacactttcgtgtggagcgcgtgattggtcgttatgataaaatg
attaaaataacaaaaaatccctttaaagctaaatag

DBGET integrated database retrieval system