KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1301Help
Entry
MGAS1882_1301     CDS       T02062                                 

Gene name
atoB.2
Definition
(GenBank) 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase protein AtoB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS1882_1301 (atoB.2)
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS1882_1301 (atoB.2)
   00640 Propanoate metabolism
    MGAS1882_1301 (atoB.2)
   00650 Butanoate metabolism
    MGAS1882_1301 (atoB.2)
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS1882_1301 (atoB.2)
   00072 Synthesis and degradation of ketone bodies
    MGAS1882_1301 (atoB.2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS1882_1301 (atoB.2)
   00310 Lysine degradation
    MGAS1882_1301 (atoB.2)
   00380 Tryptophan metabolism
    MGAS1882_1301 (atoB.2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS1882_1301 (atoB.2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS1882_1301 (atoB.2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MGAS1882_1301 (atoB.2)
Enzymes [BR:stx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS1882_1301 (atoB.2)
Exosome [BR:stx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS1882_1301 (atoB.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1275924..1277111
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctgcgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacaa
gcagcttatgtctcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaagcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagaccctttaattgttacaacagatgaataccca
aaagttgatacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system