KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1392Help
Entry
MGAS1882_1392     CDS       T02062                                 

Gene name
accD
Definition
(GenBank) acetyl-coenzyme A carboxyl transferase beta subunit AccD
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
stx00061  Fatty acid biosynthesis
stx00620  Pyruvate metabolism
stx00640  Propanoate metabolism
stx01100  Metabolic pathways
stx01110  Biosynthesis of secondary metabolites
stx01120  Microbial metabolism in diverse environments
stx01130  Biosynthesis of antibiotics
stx01200  Carbon metabolism
stx01212  Fatty acid metabolism
Module
stx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS1882_1392 (accD)
   00640 Propanoate metabolism
    MGAS1882_1392 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MGAS1882_1392 (accD)
Enzymes [BR:stx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     MGAS1882_1392 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MGAS1882_1392 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans Cys_rich_CPCC IBR RNA_POL_M_15KD
Motif
Other DBs
NCBI-ProteinID: AFC68584
Position
complement(1366097..1366963)
Genome map
AA seq 288 aa AA seqDB search
MALFRKKDKYIRITPNNSLKGSVSHNVPEVPDELFAKCPACKHMIYKKDLGLAKICPTCS
YNFRISAQERLTLTVDEGSFQELFISIETKDPLRFPGYQEKLQKAKETTGLHEAVLTGKA
MVKGQQIALAIMDSHFIMASMGTVVGEKITRLFELAIEENLPVVIFTASGGARMQEGIMS
LMQMAKVSAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVI
ETTVRENLPDDFQKAEFLQDHGFVDAIVKRTELRDKIAHLVAFHGGGQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctttatttcgtaaaaaagataaatacatccgtattactcctaataattccctcaaa
ggatctgtcagccataatgtcccagaagttccagatgaactctttgcgaaatgcccagct
tgtaagcacatgatttataagaaagatttgggattggcaaagatttgcccaacctgttct
tacaattttaggatttctgcccaagagcgactgaccttaacagttgatgaaggctctttc
caggaattatttataagtattgaaaccaaggatccgttacgttttccaggttatcaggaa
aaattacaaaaagccaaggaaacaactggtctgcatgaagctgttttgacagggaaagct
atggttaaaggacaacaaattgctcttgctattatggattctcactttattatggctagt
atgggaactgttgttggggaaaaaattacccgattgtttgaattggctatcgaagaaaac
ctgccggtggtgatttttacggcttcaggaggcgcccgtatgcaagaggggatcatgagc
ctcatgcaaatggccaaggtctctgcagctgtgaaaagacattctaatgcaggcctcttt
tacctcactattttgacagatccaactactggtggggtaacagctagttttgccatggaa
ggggatattattttggcagaacctcaatccttggttggctttgcaggtcgtcgtgtcatt
gagaccacagttcgtgaaaacttgccagatgatttccaaaaagcagaatttttacaagac
catggttttgtggatgctattgtgaaacgaacagagttgcgagacaagattgcccactta
gtagcatttcatggaggtggccaatga

DBGET integrated database retrieval system