KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1392Help
Entry
MGAS1882_1392     CDS       T02062                                 

Gene name
accD
Definition
acetyl-coenzyme A carboxyl transferase beta subunit AccD
Orthology
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGAS1882_1392 (accD)
   01212 Fatty acid metabolism
    MGAS1882_1392 (accD)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS1882_1392 (accD)
   00640 Propanoate metabolism
    MGAS1882_1392 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MGAS1882_1392 (accD)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    MGAS1882_1392 (accD)
Enzymes [BR:stx01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MGAS1882_1392 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366097..1366963)
Genome map
AA seq 288 aa AA seqDB search
MALFRKKDKYIRITPNNSLKGSVSHNVPEVPDELFAKCPACKHMIYKKDLGLAKICPTCS
YNFRISAQERLTLTVDEGSFQELFISIETKDPLRFPGYQEKLQKAKETTGLHEAVLTGKA
MVKGQQIALAIMDSHFIMASMGTVVGEKITRLFELAIEENLPVVIFTASGGARMQEGIMS
LMQMAKVSAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVI
ETTVRENLPDDFQKAEFLQDHGFVDAIVKRTELRDKIAHLVAFHGGGQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctttatttcgtaaaaaagataaatacatccgtattactcctaataattccctcaaa
ggatctgtcagccataatgtcccagaagttccagatgaactctttgcgaaatgcccagct
tgtaagcacatgatttataagaaagatttgggattggcaaagatttgcccaacctgttct
tacaattttaggatttctgcccaagagcgactgaccttaacagttgatgaaggctctttc
caggaattatttataagtattgaaaccaaggatccgttacgttttccaggttatcaggaa
aaattacaaaaagccaaggaaacaactggtctgcatgaagctgttttgacagggaaagct
atggttaaaggacaacaaattgctcttgctattatggattctcactttattatggctagt
atgggaactgttgttggggaaaaaattacccgattgtttgaattggctatcgaagaaaac
ctgccggtggtgatttttacggcttcaggaggcgcccgtatgcaagaggggatcatgagc
ctcatgcaaatggccaaggtctctgcagctgtgaaaagacattctaatgcaggcctcttt
tacctcactattttgacagatccaactactggtggggtaacagctagttttgccatggaa
ggggatattattttggcagaacctcaatccttggttggctttgcaggtcgtcgtgtcatt
gagaccacagttcgtgaaaacttgccagatgatttccaaaaagcagaatttttacaagac
catggttttgtggatgctattgtgaaacgaacagagttgcgagacaagattgcccactta
gtagcatttcatggaggtggccaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system