KEGG   Streptococcus pyogenes MGAS1882: MGAS1882_1470Help
Entry
MGAS1882_1470     CDS       T02062                                 

Gene name
recD
Definition
DNA helicase protein RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stx  Streptococcus pyogenes MGAS1882
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MGAS1882_1470 (recD)
Enzymes [BR:stx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MGAS1882_1470 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1447354..1449807
Genome map
AA seq 817 aa AA seqDB search
MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKIKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGHNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESINRGDTYVQAR
QLLDFAITLLEDARQVECDPAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIANNIS
RLLDTPLSQSFSHDTIQTTIQAVQKDFAITYDQVQQEAITKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVNLADQMRRGILATDFRDKKADRSYFEAQAAFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQELLNPLQGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYTAITRSKSKLILLGEYTAFEYAIKHEG
DKRQTYLIERFQEQSDLASSQPNQELKSKEQTSLFSNTATLEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtttttacaggtactgttgatcgtatcatttttgaaaaccaggctaatttc
tttaaaattctcctccttgccattgaggatacagacagtgacattgacgactttgaaatc
attatcacaggaacgatggctgacattattgaaggagatgactacaccttttggggagaa
ttgacccagcaccctaaatacggtcaacaactcaagctaagccgttaccaaaaaatcaaa
cctagttcatctggtttggttaattatttctctagtgaccattttaaggggattggtaaa
aaaacagcggagaaaatcattgcactatatggtcataataccattgaccatattttagaa
gacccaagcaaattagaaactatctctggcctatctaaggctaatcgtcaagcctttgtc
gctaaactaaaattgaattacggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgaaaagtataaagaagaggctcttgacctt
gttaaagaaaatccctatcagttagtcgaagatctacaaggttttgggtttaaaatggca
gatgctctcgctgaaaacttagggattgaaagcgactctccgaaacgttttcgtgcagcc
ctccttcactgtctcttggaagaatccatcaatcgaggagatacttatgtccaagcacga
caattattagactttgccattacactccttgaagatgcacgtcaagtagaatgtgatcct
gctgctgtggctgaacaactaagcgagttgatcatagagggcaaaatcaaaaacagtgac
accaaactgtttgatgctagcctttattttgctgaagaagggattgctaacaacatctct
cgtctcttagatactcctttaagtcagtcatttagtcatgatactattcaaacaaccatc
caagccgttcaaaaagactttgccatcacctatgaccaagtgcagcaagaagccattact
aaggccttaaccagcaaggtctttctcctaacaggtggtcccggaacaggaaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgcatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaatggcgacaacgattac
caagccatggaggattatctagactgcgacctgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccagttgttaggagcgattaactcaacaactcaagtgattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtcaatttggcagaccagatgcgtcgaggaatcttagctactgactttcgtgat
aaaaaagctgaccgttcttattttgaagcccaagcagcctttatccctgacatgattcaa
aaaattgtcctctctgccattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaagctggcatcaatcatcttaatcaactcatgcaagaacttctc
aatcccttgcaaggacaaacagaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcttgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatataccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccttagcctat
gccatgagcattcataagtcacaagggagcgagtttcaagtggtgattttacctatcaca
cgccaaagcggccgactcttgcaacgaaatgtgatttacacggccattactcggtctaaa
agtaagttaattctgttgggagaatatactgcctttgagtatgctattaaacacgaaggc
gataaacgccaaacctacttgatcgaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagagcagacctcccttttttctaatacggcaacc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagaatcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system