KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: HCM1.165cHelp
Entry
HCM1.165c         CDS       T00064                                 

Gene name
dhfR
Definition
(RefSeq) dihydrofolate reductase
  KO
K18589  dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00670  One carbon pool by folate
sty00790  Folate biosynthesis
sty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HCM1.165c (dhfR)
   00670 One carbon pool by folate
    HCM1.165c (dhfR)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HCM1.165c (dhfR)
Antimicrobial resistance genes [BR:sty01504]
 Gene variants
  Trimethoprim resistance genes
   Dihydrofolate reductases
    HCM1.165c (dhfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 1251383
NCBI-ProteinID: NP_569370
GeneDB: HCM1.165c
UniProt: Q935L0
Position
pHCM1:complement(120417..120899)
Genome map
AA seq 160 aa AA seqDB search
MRTLKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNR
KYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLST
IDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccttgaaagtatcattgatggctgcgaaagcgaaaaacggcgtgattggttgc
ggtccagacataccctggtccgcgaaaggggagcagctactttttaaagcattgacctac
aatcagtggcttctggtgggtcgcaagacgtttgaatctatgggcgcactccccaatagg
aaatacgcggtcgttacccgctcaggttggacatcaaatgatgacaatgtagttgtattt
cagtcaatcgaagaggccatggacaggctagctgaattcaccggtcacgttatagtgtct
ggtggcggagaaatttaccgagaaacattacccatggcctctacgctccacttatcgacg
atcgacatcgagccagagggggatgttttcttcccgagtattccaaataccttcgaagtt
gtttttgagcaacactttacttcaaacattaactattgctatcaaatttggaaaaagggt
taa

DBGET integrated database retrieval system