KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: HCM2.0117cHelp
Entry
HCM2.0117c        CDS       T00064                                 

Definition
putative dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sty00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sty00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
pHCM2:complement(90712..91188)
Genome map
AA seq 158 aa AA seqDB search
MKMIAAVGRNYEIGIGNELPWRCPTDLKLFKQLTKNATVVMGRKTMESLKRPLPERHNLV
LTRSRGYIPNGFYPAGIDDVLRLPDPVWVIGGGQIYSLFMPHVEEIWLSHIGVDVPGADA
FFPAPMMRSLGFVPVETAYTQRANEDEPGFLQIVYRRS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgattgcagctgtcggccgcaactatgaaatcggcattggcaacgaacttccc
tggcgttgcccgaccgatctgaaactgttcaaacaactcaccaaaaacgccactgtcgtg
atgggacgcaagacgatggaaagtctcaagcgcccgctgccagagcgccataacctcgtt
ttgacgcgctctcgtgggtatatccccaatgggttctaccccgctggcatcgatgacgtt
ttgagactgccagatccggtctgggtgattggtggcgggcagatttactcgctctttatg
ccacacgtagaagagatctggctgtcgcatattggcgtggatgtgccgggcgcggatgcg
ttcttcccggcgccaatgatgcgttctttagggttcgtaccagtcgaaacggcttatacc
caacgtgcaaatgaggatgagcctggctttttgcagatcgtatacagaaggtcgtaa

DBGET integrated database retrieval system