KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0243Help
Entry
STY0243           CDS       T00064                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00900  Terpenoid backbone biosynthesis
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01130  Biosynthesis of antibiotics
Module
sty_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STY0243 (dxr)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     STY0243 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-GeneID: 1246732
NCBI-ProteinID: NP_454827
GeneDB: STY0243
UniProt: Q8Z9A6
Position
254731..255927
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVHHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTS
SAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTS
ILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFC
KLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLN
LAVLERMDLHEPASVDDVLQVDAIAREVARKQVIRLSR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccattctgggctcgaccggctctattggttgcagcacactggacgtg
gtgcaccataatcctgatagctttcgcgttatcgcgctggtggcgggtaaaaatgtcgcc
cgcatggcggagcagtgcctggagttctcgccgcgttatgccgtgatggacgatacgtcg
agcgcagaacagctcaaaataatgcttcagcagcatggcagccgcaccgaggttctgagc
ggtcagcaggctgcctgtgagatggcggcgcttgatgaggttgggcatgtgatggcggcc
attgtgggcgcggctggtttactgccgaccttggcggcgatccgcgcagggaagacgatt
ctgctggcgaataaagaatcgctggtgacctgcgggcggctgtttatggacgaagtgaaa
cgcagcaacgcccggcttttacccgtcgatagcgaacataacgcgatttttcagagtttg
ccgcaatctattcagcataatctgggatacgctgaccttgagcaaaatggcgtaacgtcg
attttgcttaccgggtctggtggcccgtttcgtgaaacgcccatgtgcgatctggcagcg
atgacgccggatcaggcatgtcgtcatccgaactggtcgatggggcgaaaaatctccgtc
gactccgccaccatgatgaataaaggtctggaatacattgaagcgcgttggttatttaat
gccagcgcacgtcagatggaagtgttgatccatccgcaatcggtcattcattcgatggtg
cgttatcaggacggcagcgtcctggcgcagcttggagaacctgacatgcgtacgcctatt
gcgcatacgatggcatggccgaatcgcgtcacgtccggcgcgcagccgctcgatttttgc
aaactcagcgcgctgacgtttagcgcgccagattatcagcgttatccttgcctgaagctg
gcgatggaggcgtttgagcaaggtcaggcggcaacgacggcgctcaatgcggcaaacgaa
atcaccgttgccgcgtttctggcgcaacagattcgttttaccgatatcgccgggctcaat
ttagcggtgctggagaggatggatttacacgaaccggcaagcgttgatgacgtattgcag
gttgacgccatcgcgcgtgaagtagccagaaaacaagtgatacggctctcacgctga

DBGET integrated database retrieval system