KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0638Help
Entry
STY0638           CDS       T00064                                 

Gene name
fepB
Definition
ferric enterobactin ABC transporter substrate-binding protein
Orthology
K02016  
iron complex transport system substrate-binding protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:sty00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    STY0638 (fepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(639109..640065)
Genome map
AA seq 318 aa AA seqDB search
MRLSAFYRWLLLVVGLSISGISLAQDAGWPRQIQDSRGVHTLDHKPARIVSTSVTLTGSL
LAIDAPVVASGATTPNNRFADDQGFMRQWSDVAKARHVARLYIGEPNAETVAAQMPDLIL
ISATGGDSALALYDQLSAIAPTLVINYDDKSWQSLLTQLGEITGQEKQAAARIAEFEAQL
TTVKQRIALPPQPVSALVYTPAAHSANLWTPESAQGKLLTQLGFTLATLPQGLQTSKSQG
KRHDIIQLGGENLAAGLNGESLFLFAGDNNDVAALYANPLLAHLPAVQNKRVYALGTETF
RLDYYSATLLLNRLAALF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgagactctccgccttttatcgttggctgcttttagtggttggtttatcaatttcagga
atatccttagcccaggacgccggttggccccggcaaatccaggacagccgaggcgttcat
actctggaccacaaacccgcgcgtatcgtctctaccagcgtgacgttaacaggctcgctg
ctggcgattgatgcgcccgtcgtcgccagcggagccactacgccgaataaccgttttgcc
gacgatcaagggtttatgcgccagtggagcgatgtagcaaaggctcgccatgtcgcccgg
ctgtacatcggcgaaccgaatgccgaaacggtcgccgcgcaaatgccggatctcattttg
attagcgccaccggcggcgactccgcgctggcgctttacgatcagctctccgccatcgcg
ccgacactcgtcatcaattatgacgataaaagctggcagagtttgctcacgcagcttggc
gagatcaccggtcaggagaaacaggccgccgcgcgaatagcggaatttgaggcgcaactg
acgacggttaaacagcgaatcgccctgccgccgcagccggttagcgcgctggtgtatact
cctgccgcgcatagcgccaatctgtggacgccagaatcagcacaaggcaagctattgacg
cagttaggctttacgctggcgacattgccccaagggctgcaaaccagcaaaagccagggt
aagcgccacgatatcattcagcttggcggtgaaaatctggccgccgggttaaacggcgaa
tctcttttcctgtttgccggcgacaacaacgatgttgcggccctttacgccaatccgctg
ctggcgcacctgccagcggtgcaaaataagcgcgtctatgccctgggtacggagacgttc
cgtctggattattacagcgcaacgttgctgcttaatcgactggccgccctgttttag

DBGET integrated database retrieval system