KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0718Help
Entry
STY0718           CDS       T00064                                 

Gene name
asnB
Definition
(RefSeq) asparagine synthetase B
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00250  Alanine, aspartate and glutamate metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STY0718 (asnB)
Enzymes [BR:sty01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     STY0718 (asnB)
Peptidases [BR:sty01002]
 Cysteine Peptidases
  Family C44
   STY0718 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 1247175
NCBI-ProteinID: NP_455241
GeneDB: STY0718
UniProt: Q8Z8G3
Position
complement(714919..716583)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAAELRKKALELSRLMRHRGPDWSGIYACDNAILAHERLSIVDVNAGA
QPLYNAKKTHVLAVNGEIYNHQTLRAEYGDRYAFQTGSDCEVILALYQEKGPDFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNALRQALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMYDCTRANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPSSKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMDD
PSGRAVGVHQSAYQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggcgtattcgatatcaaaacagatgcagcggaactgcgtaaaaaa
gcccttgaattgtcacgcctgatgcgccatcgcggcccggactggtccggcatctacgct
tgcgataacgcgattctcgcacatgaacgcttgtcgattgttgatgttaacgccggcgcc
cagcccctgtataacgctaagaaaactcacgtgctggcggtgaacggtgaaatttataac
catcagacgttacgcgcggagtatggcgatcgttacgcgttccagactggctccgactgc
gaagttattctcgcgctatatcaggaaaaagggccggatttccttgacgatttacagggg
atgttcgccttcgccctgtatgacagcgaaaaagacgcttatctgattggtcgtgaccat
atcggtattattccgctctacatgggctatgacgaattcggcaacttctacgtagcgtca
gaaatgaaagcgctgactccggtctgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgtcagtactatcagcgcgactggttcgattacgat
gcggtaaaagataacgtcaccgacaaaaacgcgctgcgtcaggcgctggaagaatccgtg
aaaagccacctgatgtccgacgtgccctacggcgtactgctctccggcggcctggactcg
tcggttatctcggcaatcaccaaaaaattcgccgcccgtcgcgtcgaagatcaggagcgc
tccgaagcctggtggccacagttgcactcttttgcggtaggtctggaaggttcgcctgac
ctgaaggcggcccaggaagtggctaaccacctcggcaccgtgcatcatgaaattcacttc
accgtccaggagggtctggatgcgattcgcgacgtgatttaccacattgaaacctatgac
gtaaccactatccgcgcctcaacgccaatgtatctgatgtcgcgtaagatcaaagcgatg
ggcatcaaaatggtgctctccggcgaaggttctgatgaggtgtttggcggctacctgtac
ttccataaagcgccgaacgccaaagagttacatgaagagacggtccgtaagctacaggcg
ctgcatatgtatgactgcacccgcgccaacaaagcgatgtccgcctggggcgtggaagcg
cgcgtaccgttcctggataaaaaattcctcgacgtggcgatgcgtatcaacccacaggat
aaaatgtgcggcaacggcaagatggaaaaacacgtgctgcgcgagtgcttcgagtcttat
ctgccagcaagcgtggcgtggcgtcagaaagagcagttctctgacggcgtaggctacagc
tggattgatacgctgaaagaggtggcggcgaaacagatttccgatcaacaactggaaaca
gcccgcttccgctttccatacaacacgccgtcgtctaaagaggcgtacttgtaccgggaa
atttttgaagaattgttcccggtgccgagcgccgcggaatgcgtacccggcggcccgtcc
gtggcctgttcttccgccaaagccattgagtgggatgaagcattcaaaacgatggatgac
ccgtcaggccgcgcggtcggcgtgcatcagtcggcgtaccagtaa

DBGET integrated database retrieval system