KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0819Help
Entry
STY0819           CDS       T00064                                 

Gene name
ybhC
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STY0819 (ybhC)
   00500 Starch and sucrose metabolism
    STY0819 (ybhC)
Enzymes [BR:sty01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     STY0819 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(814916..816199)
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAARYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAIDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRRAVNPGGKYMPGKPAWY
MFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDTNYNRMWEYNNRGVGSK
VVTEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcagatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgccccattctgtcggcaaatgaagcgaaaaacttcgttgctgcgcgctattttgcc
tccctgacgccgaataccgccccgtggtcgccgtcgccgattaccctgcccgcacagcct
gactttgtggtggggccggcaggtacgccaggcgttacgcacacctcgattcaggccgcg
atcgatgcggcaatggttaaacgcacgaacaaacgccagtacattgctattatgccgggc
gactatcaggggaccgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggacc
ggtgaaaaaccgatcgatgtaaaaattgggatggcgattgatggtgaaatgagtgtcgct
gactggcgccgcgcagtgaatcccggcgggaaatatatgcctggtaaacccgcctggtat
atgttcgataactgccaaagcaaacacgccgcgacgatcggtgtaatgtgttctgccgcg
ttctggtcgcagaataacggtctgcagctacaaaatctgaccatcgagaacacgctgggc
gacagtgtcgatgccggaaaccatccggcggtggcgctgcgtaccgatggcgacaaagtc
cagattaacaaggtcaatatccttggccgccagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaaaccgatcgccagccgcgtacgctggtgacgaacagctatatt
gaaggcgatgtggatatggtttccggacgcggcgccgtggtgttcgataacaccaacttc
caggtcgtcaactcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtcc
aatatttactatggctttttggcgatcaacagccgctttaacgcctccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgccaacaccaacggtcaggtcgtgatccgc
gacagcgtgattaacgagggcttcaacgttgccaaaccgtgggccgacgcggtcatctcg
aaacgtccgtttgctggaaatacgggaaccgtggatgacaaagacgaggtgcagcgtaat
ctgaacgacacgaactacaaccgcatgtgggaatacaacaaccgcggtgtaggcagtaaa
gtagtgacggaacctaagcagtaa

DBGET integrated database retrieval system