KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY1726Help
Entry
STY1726           CDS       T00064                                 

Gene name
spiA
Definition
(RefSeq) outer membrane secretory protein
  KO
K03219  type III secretion protein C
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty03070  Bacterial secretion system
Module
sty_M00332  Type III secretion system
Brite
KEGG Orthology (KO) [BR:sty00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    STY1726 (spiA)
Secretion system [BR:sty02044]
 Type III secretion system
  Type III secretion core apparatus [MD:M00332]
   STY1726 (spiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretin Secretin_N DUF4974
Motif
Other DBs
NCBI-GeneID: 1248100
NCBI-ProteinID: NP_456134
GeneDB: STY1726
UniProt: Q8Z6L1
Position
complement(1644774..1646267)
Genome map
AA seq 497 aa AA seqDB search
MVVNKRLILILLFILNTAKSDELSWKGNDFTLYARQMPLAEVLHLLSENYDTAITISPLI
TATFSGKIPPGPPVDILNNLAAQYDLLTWFDGSMLYVYPASLLKHQVITFNILSTGRFIH
YLRSQNILSSPGCEVKEITGTRAVEVSGVPSCLTRISQLASVLDNALIKRKDSAVSVSIY
TLKYATAMDTQYQYRDQSVVVPGVVSVLREMSKTSVPASSTTNGSPATQALPMFAADPRQ
NAVIVRDYAANMAGYRKLITELDQRQQMIEISVKIIDVNAGDINQLGIDWGTAVSLGGKK
IAFNTGLNDGGASGFSTVISDTSNFMVRLNALEKSSQAYVLSQPSVVTLNNIQAVLDKNI
TFYTKLQGEKVAKLESITTGSLLRVTPRLLNDNGTQKIMLNLNIQDGQQSDTQSETDPLP
EVQNSEIASQATLLAGQSLLLGGFKQGKQIHSQNKIPLLGDIPVVGHLFRNDTTQVHSVI
RLFLIKASVVNNGISHG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaaataaacgtttaatcttaattttactatttatactcaatacagcaaagagt
gatgagttatcatggaaaggtaatgacttcaccctttatgccagacaaatgccattagca
gaggttttacatctgctctcagagaactatgatacggctattactattagcccattgata
acagctacatttagtggaaaaattccgcctggaccaccggtcgatattttgaataacctg
gcagcacaatatgatttgctaacctggtttgatggcagcatgttatatgtatatcctgca
tcgttattaaaacatcaggttatcactttcaatattttatctactggacggttcattcat
tacttacgcagccagaatatcctttcatcaccgggatgcgaggttaaagaaattaccggt
accagagctgtggaggtgagtggtgttcccagctgtctgactcgtattagtcaattagct
tcagtgctggataatgcgttaatcaaacgaaaagacagtgcggtgagtgtaagtatatac
acgcttaagtatgccactgcgatggatacccaataccaatatcgcgatcagtccgtcgtg
gttccaggggtcgtgagtgtattgcgtgagatgagtaaaaccagcgtaccggcgtcatcg
acgaccaatggttcacccgctacacaggcattgcccatgtttgctgccgacccacgccag
aatgcagtgatcgttcgtgattatgcggccaatatggccgggtatcggaaactcatcaca
gaattagatcaacgccagcagatgatagagatttcggtgaaaattatcgatgttaatgct
ggagatattaaccagttaggcatcgactggggaacggcagtgtcgctgggtggcaagaaa
attgcgttcaatacaggtttgaatgacggtggtgctagcggtttttcaacggtaatcagc
gatacctcaaactttatggtgcgtttgaatgccctggaaaaaagctctcaggcttatgta
ctttcccagccatctgtggtgactttaaataatatccaggctgtgctggataaaaatatt
actttctataccaaactgcagggagaaaaagtggctaaacttgaatccatcactacgggt
tctttgttgcgcgttacacctcgcttgttaaatgacaatggcacgcaaaaaataatgctt
aatcttaatattcaggatggacaacaaagtgatacgcaaagcgaaacagatccgctaccc
gaagtgcaaaattctgaaattgcttcgcaagccacattattggccggacaaagtctattg
ctgggagggtttaaacaaggtaaacaaatccactcgcaaaacaaaatccctttattgggc
gatatccctgtcgtaggtcatttgtttcgcaatgatacgactcaagtacatagtgtaatc
aggctttttttgattaaagcctcagtagtaaataatggcatatctcatggttaa

DBGET integrated database retrieval system