KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY1815Help
Entry
STY1815           CDS       T00064                                 

Gene name
gdhA
Definition
NADP-specific glutamate dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sty00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sty00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sty00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1733274..1734617
Genome map
AA seq 447 aa AA seqDB search
MDQTCSLESFLNHVQKRDPHQTEFAQAVREVMTTLWPFLEQNPRYRHMSLLERLVEPERV
IQFRVVWLDDKNQVQVNRAWRVQFNSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGPDTDVPAGDIGVGGREVGFMA
GMMRKLSNNSACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGLGFEGMRVAVSGS
GNVAQYAIEKAMAFGARVVTASDSSGTVVDESGFTPEKLARLCEIKASRDGRVADYAREF
GLTYLEGQQPWSVPVDIALPCATQNELDVDAARVLIANGVKAVAEGANMPTTIEATDLFL
EAGVLFAPGKAANAGGVATSGLEMAQNAARLSWKAEKVDARLHHIMLDIHHACVKYGGDN
KHTNYVQGANIAGFVKVADAMLAQGVI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacatgttctctggaatcgttcctcaaccatgtacaaaagcgcgacccgcat
caaaccgagttcgcgcaagccgtccgtgaagtcatgaccaccctgtggccgtttcttgaa
caaaacccccgttaccgccacatgtctttactggaacgtttggttgaaccagagcgcgta
atccagtttcgcgtagtgtggctggacgataaaaatcaggtgcaggtaaatcgcgcctgg
cgcgtgcagttcaactctgctatcggcccctataaaggcggtatgcgcttccatccttcg
gtaaacctttccatccttaagttcctcggctttgagcaaacctttaaaaatgccctcacc
acgttgccgatgggcggcggtaaaggcggcagcgatttcgatccgaaagggaaaagcgaa
ggcgaagtgatgcgtttctgccaggcgctgatgactgaactgtatcgccatttagggccg
gataccgacgtgcctgccggggatatcggcgtgggcgggcgcgaagtgggctttatggcg
ggaatgatgcgcaagctttccaataacagcgcctgcgtcttcaccggcaaagggctttcc
ttcggcggcagcctgattcgtccggaggcgacgggctatggcctggtctacttcaccgaa
gcgatgcttaaacgtcatggtctcggttttgaagggatgcgcgtcgccgtgtccggctcc
ggcaacgtagcgcaatacgccattgagaaagcgatggcctttggcgcgcgcgtggttacc
gcgtcggattcgagcgggacggtggtcgatgaaagtggcttcacgccagagaagctggcg
cggctgtgtgaaattaaagccagccgtgacggtcgcgtcgctgactacgcccgtgagttt
ggcttaacctatctggaaggccagcagccctggagcgtaccggtggatatcgccctgcca
tgcgcgacgcagaacgaactggacgttgacgccgcgcgcgtactgattgccaatggcgtg
aaagccgtggcggaaggggcaaatatgccaaccacgattgaagcgaccgatctcttcctt
gaggcgggcgtactgtttgcgccgggtaaagccgccaacgcgggcggcgtggcgacatcg
gggctggaaatggcgcagaacgccgcgcggttgagctggaaagccgagaaagtggacgcc
cgtctgcatcatattatgctggatatccaccacgcctgtgtcaagtacggcggcgacaat
aagcatactaactacgttcagggcgccaacatcgccggtttcgtgaaagtcgccgacgcc
atgctggcgcagggcgtcatttaa

DBGET integrated database retrieval system