KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2044Help
Entry
STY2044           CDS       T00064                                 

Definition
endolysin (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1912585..1913061)
Genome map
AA seq 158 aa AA seqDB search
MQTLNSQRKAFLDMVAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLK
STAAGRYQLLSRWWDAYRKQLGLKDFSPESQDAVALQQIKERGALPMIDRGDIRQAIDRC
SNIWASLPGAGYGQYEHRIGDLISRFKEAGGVVNEAEI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacttaattcccagcgtaaagctttccttgatatggtggcatggtcagaagga
acagataacggacggcagaaaaccagaaatcacggttatgatgttattgtcggtggcgaa
ctgttcactgattactccgatcacccccgcaaacttgtcacgctaaatccgaaactcaaa
tcaacagccgctggacgttaccagcttctttcacgctggtgggatgcctaccgcaagcaa
cttggcctgaaagatttttctccagaaagtcaggatgctgtagcgctgcagcaaattaaa
gagcgtggcgctttaccgatgattgaccgcggcgatattcgtcaggcaatcgaccggtgc
agcaatatctgggcgtcgttacctggtgcaggttacggtcagtatgaacatagaatcggt
gacctgatttcccgatttaaagaagctggtggggtggtaaatgaagctgagatataa

DBGET integrated database retrieval system