KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2103Help
Entry
STY2103           CDS       T00064                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sty00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STY2103 (ruvA)
Enzymes [BR:sty01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STY2103 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1955713..1956324)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggcgtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccacttcgtggtgcgtgaagatgcgcagttgctg
tacggatttaacaataagcaagagcgcacgctatttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgatcctctccggcatgtcggcgcagcagtttgtgaat
gcggttgagcgcgaagagctgggtgcgctggtgaagctgccgggtatcggcaagaaaacc
gccgaaaggctgattgtcgaaatgaaagaccgctttaaagggctacatggcgatctcttt
acgccagcggtcgatctggtattgacgtcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagtcggatg
gtaagtaagatcgcccgtccggacgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgctatga

DBGET integrated database retrieval system