KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2281Help
Entry
STY2281           CDS       T00064                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00340  Histidine metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01230  Biosynthesis of amino acids
Module
sty_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    STY2281 (hisD)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     STY2281 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 1248616
NCBI-ProteinID: NP_456620
GeneDB: STY2281
UniProt: Q8Z5K0
Position
2107398..2108702
Genome map
AA seq 434 aa AA seqDB search
MSFNTLIDWNSCSPEQQRALLTRPAISASDSITRTVSDILYNVKTRGDDALREYSAKFDK
TEVTALRVTPEEIAAAGARLSDELKQAMAAAVKNIETFHSAQTLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAQLCGVQE
IFNVGGAQAIAALAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADIARKVAEAVERQLAELPRAGTARQ
ALSASRLIVTKDLAQCVAISNQYGPEHLIIQTRNARDLVDAITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKAGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccctgattgactggaacagctgtagccctgaacagcagcgtgcgctg
ctgacgcgtccggcgatttccgcctctgacagtattacccggacggtcagcgatattctg
tataatgtaaaaacgcgcggtgacgatgccctgcgtgaatacagcgctaaatttgataaa
acagaagtgacagcgctacgcgtcacccctgaagagatcgccgccgccggcgcgcgtctg
agcgacgaattaaaacaggcgatggccgctgccgtcaaaaatattgaaacgttccattcc
gcgcagacgctaccgcctgtagatgtggaaacccagccaggcgtgcgttgccagcaggtt
acgcgtcccgtcgcgtctgtcggtctgtatattcccggcggctcggctccgctcttctca
acggtgctgatgctggcgacgccggcgcgcattgcgggatgccagaaggtggttctgtgc
tcgccgccacccatcgctgatgaaatcctctatgcggcgcaactgtgtggcgtgcaggaa
atctttaacgtcggcggcgcgcaggcgattgccgctctggccttcggcagcgagtccgta
ccgaaagtggataaaatttttggccccggcaacgcctttgtaaccgaagccaagcgtcag
gtcagccagcgtctcgacggcgcggctatcgatatgccagccgggccgtctgaagtgctg
gtgatcgccgacagcggcgcaacaccggatttcgtcgcttctgacctgctctcccaggct
gagcacggcccggattcccaggtgatcctgctgacgccggatgctgacattgcccgcaag
gtggcggaggcggtagaacgtcaactggcggaactgccgcgcgcgggcaccgcccggcag
gccctgagcgccagtcgtctgattgtgaccaaagatttagcgcagtgcgtcgccatctct
aatcagtatgggccggaacacttaattatccagacgcgcaatgcgcgcgatttggtggat
gcgattaccagcgcaggctcggtatttctcggcgactggtcgccggaatccgccggtgat
tacgcttccggaaccaaccatgttttaccgacctatggctatactgctacctgttccagc
cttgggttagcggatttccagaaacggatgaccgttcaggaactgtcgaaagcgggcttt
tccgctctggcatcaaccattgaaacattggcggcggcagaacgtctgaccgcccataaa
aatgccgtgaccctgcgcgtaaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system