KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3051Help
Entry
STY3051           CDS       T00064                                 

Gene name
pcm
Definition
L-isoaspartyl protein carboxyl methyltransferase type II
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
Enzymes [BR:sty01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     STY3051 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2917429..2918055)
Genome map
AA seq 208 aa AA seqDB search
MVSGRVQALLEQLRAQGIRDELVLNALAAVPREKFIDEAFEHKAWENIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMAQLDEGGILVLPVGDEQQFLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtggacgtgtacaggctcttcttgaacaattgcgcgcgcagggcatcagagat
gagctggtgcttaatgcgcttgccgcagtgccgcgcgagaaatttattgatgaagcgttt
gaacataaggcctgggaaaatatcgctttgccgataggccagggtcagacgatttcgcag
ccctatatggtggcgcgaatgacggaactgctcgaactgacgccgcaatccagggtgttg
gaaattggcaccggttccggctatcagacggcgattctagcgcatctggtacatcacgtt
tgctccgttgagcggattaaggggctgcaatggcaggcgcgccgccgcctgaagcagctc
gatttacataatgtttctacccgtcatggcgatggctggcaaggctggcaggcgcgtgcg
ccgtttgacgctatcattgtgacggccgcgccgccggaaattcctaccgcgctcatggca
cagttggatgaaggcggcattcttgttctgcctgtgggcgatgagcagcagtttttgaaa
cgcgtgcgtcgccggggcggcgaatttattatcgataccgtggaggccgttcgcttcgtc
ccgttagtcaagggagagctggcctag

DBGET integrated database retrieval system