KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3682Help
Entry
STY3682           CDS       T00064                                 

Gene name
nucD
Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
Enzymes [BR:sty01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     STY3682 (nucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3533436..3533909
Genome map
AA seq 157 aa AA seqDB search
MLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIGNTSGVIPGKTITE
RQAAEGLISNVLRVERALERCVKQQPPQKVYDAAVSFAFNVGTGNACSSTLVKLLNQRRW
ADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgctggctattgctgccacgctgccgggttttcagcagcttcacacctccgtggagggg
ctgaaactgattgccgattacgaaggttgtcgtctgcagccgtatcagtgcagcgcgggt
gtctggaccgacggcattggtaatacgtcaggcgtcattcccggcaaaaccattacggag
cgacaggcagcagaagggctgatctccaacgtgctgcgtgtggagcgggcgctggaaagg
tgtgtgaagcaacagccgccgcagaaggtgtatgacgctgcggtgtcgtttgccttcaac
gtgggaacgggcaatgcctgcagttccacactggtgaaattactcaatcagcggcgctgg
gcggatgcgtgccgacagttgccgcgctgggtttatgtgaaaggtgtttttaatcagggg
ctggataaccgccgtgcgcgggagatggcctggtgcttacagggagcaaactga

DBGET integrated database retrieval system