KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3789Help
Entry
STY3789           CDS       T00064                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STY3789 (tpiA)
   01230 Biosynthesis of amino acids
    STY3789 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STY3789 (tpiA)
   00051 Fructose and mannose metabolism
    STY3789 (tpiA)
   00562 Inositol phosphate metabolism
    STY3789 (tpiA)
Enzymes [BR:sty01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STY3789 (tpiA)
Exosome [BR:sty04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STY3789 (tpiA)
  Exosomal proteins of bladder cancer cells
   STY3789 (tpiA)
  Exosomal proteins of melanoma cells
   STY3789 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3654396..3655163
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDTVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactgacgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaggatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgagctgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtgtgcgcacgccagatcgacacggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttacgaacccgtatgggcgatcggtaccggtaaatctgcaactcct
gcgcaggctcaggcagttcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggttattatccagtacggcggttctgttaatgcgtccaacgcagccgaa
ctgttcgcgcagccggacatcgacggcgcactggtaggcggcgcttctctgaaagctgac
gccttcgccgtgatcgtgaaagcagcagaagctgctaaacaggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system