KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3809Help
Entry
STY3809           CDS       T00064                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STY3809 (pfkA)
   01230 Biosynthesis of amino acids
    STY3809 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STY3809 (pfkA)
   00030 Pentose phosphate pathway
    STY3809 (pfkA)
   00051 Fructose and mannose metabolism
    STY3809 (pfkA)
   00052 Galactose metabolism
    STY3809 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    STY3809 (pfkA)
Enzymes [BR:sty01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STY3809 (pfkA)
Protein phosphatases and associated proteins [BR:sty01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STY3809 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3672144..3673106)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttccgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctac
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgaa
gatctggtggccgaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
attactgagcatatgtgcgatgttgacgaactggcgcactttattgaaaaagaaacgggc
cgtgaaacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system