KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3830Help
Entry
STY3830           CDS       T00064                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STY3830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STY3830
  Lipid metabolism
   00071 Fatty acid degradation
    STY3830
  Amino acid metabolism
   00350 Tyrosine metabolism
    STY3830
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STY3830
   00626 Naphthalene degradation
    STY3830
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STY3830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3690386..3691534
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMS
YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVML
EIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFA
RIAQAMGVETRGMSDEVASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgccgat
atggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggtcaa
ctggtaaagctgggcctgctggatagcctgtttagcgcactggatgaacatcaaatgtct
taccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggtttt
gcggcgtatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccgatc
gataccgcaaaagcggtgaaaattctgaccgccaacccaggtccatctaccgcctactcc
ggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggcaggt
accgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaagag
gtgatcatcgacccgaatatcatcccggatattgccgtggatgacgccagcgtcatgctg
gaaatcccggcgtctgtgaccgccgcaaccggcatggatgccctgacccatgcggtggaa
gcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgattcgc
ttaatcaatgtgtggctaccgaaagcggttgacgatggtcataacctcgaagcccgtgag
caaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttggggctg
gttcacgcgctggcgcaccagccgggcgcaacccacaacctgccgcacggcgtctgcaac
gctatcctgctgccaattgtcgagaactttaaccgtccgaacgccgtcgcgcgttttgcc
cgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagtcgcaagtcag
gaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttcagc
aagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgacccg
tgcgcgccgtgtaacccgcgcaccgccagccgcgatgaagttcgcgagctgtacctggag
gcgttatga

DBGET integrated database retrieval system