KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3989Help
Entry
STY3989           CDS       T00064                                 

Definition
(RefSeq) carbohydrate kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STY3989
Enzymes [BR:sty01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     STY3989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 1250232
NCBI-ProteinID: NP_458144
GeneDB: STY3989
UniProt: Q8XGW5
Position
3854206..3855126
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDTYDHIRAAARSLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAF
RVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
YLSLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttattggctctaacatggtggaccttatcacctacaccaaccagatg
cccaaagaaggggaaactctggaagcgccggcgtttaaaatcggctgcggcggaaaaggg
gcgaaccaggccgtggcggccgctaagctcaattcaaaagtattgatgttgaccaaagtg
ggcgacgatatttttgccgacaacaccattcgtaatctcgaatcctgggggatcaatacg
acgtatgtagaaaaagtaccgtgtaccagcagcggcgtagcgccgattttcgtcaacgcc
aactccagcaacagcattctgatcatcaaaggcgctaacaagtttctctcgccggaagat
atcgatcgcgcggcggaagatttaaaaaaatgccagcttattgttctgcaactggaagtt
cagcttgaaacggtttatcacgcaatagaatttggcaagaaacacgggattgaagtgtta
ttaaaccctgcgccagcattacgggaattagatatgtcttatgcctgtaaatgcgatttc
tttgtacctaatgaaaccgagctggaaatattaaccggtatgccagtggatacctatgac
catattcgcgcagcggcacgttcgctggtagataaagggctgaacaatattattgtcacc
atgggcgagaaaggcgcgctgtggatgacgcgtgaccaggaagtccatgttccggcgttt
agagtgaacgctgttgataccagcggcgcgggcgatgcctttatcggctgtttcgcgcat
tactacgtccagagcggggatgtggaagccgccatgaaaaaagccgtcctctttgccgct
ttcagcgtcaccgggaaaggcacccaatcctcttatccaagcattgagcaatttaatgag
tatctttcgttgaacgaataa

DBGET integrated database retrieval system