KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4183Help
Entry
STY4183           CDS       T00064                                 

Gene name
yhjM
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sty00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4044889..4045998
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITMIVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEVGTALLKRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETSPKGFSPDWVRYESKQGWQLKAEKTLI
SSYDAIRVYLWTGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVG
FSAALLPFLQNRGAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgatgatcgtcatgctgacggcaataaatgcg
caggcagcgtgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcag
ggacgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcagagctac
gccatgttctttgccctggcggcgaacgatcgaccggcgttcgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggatcgctgcgtgaacatctgcccgcctggctgtgggga
caaaaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatc
tggatggcatggtcgctgctggaggccggtcgcctgtggaaagagacgcgttataccgag
gtgggcacggcgttgctaaaacgcatcgcccgcgaagaggtcgtgaatgtgccggggctg
ggctcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaac
ccaagctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcg
acgctacgggaaaccaatttgcggcttttgttggaaacctcgccgaaaggtttctcgccg
gactgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatc
agtagctacgatgcgattcgcgtctatttatggacgggaatgatgcatgatggcgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggc
gttccaccggagaaagtggatgtcgtcagcgggaatgcgcaagggacggggccggtcggg
ttttccgccgctttactgcctttcctgcaaaatcgcggcgcccaggccgtgcagcgacag
cgggtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctcttt
ggacaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system