KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4401Help
Entry
STY4401           CDS       T00064                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00620  Pyruvate metabolism
sty00630  Glyoxylate and dicarboxylate metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01120  Microbial metabolism in diverse environments
sty01200  Carbon metabolism
Module
sty_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    STY4401 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    STY4401 (aceB)
Enzymes [BR:sty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     STY4401 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 1250618
NCBI-ProteinID: NP_458503
GeneDB: STY4401
UniProt: Q8Z1W0
Position
4264737..4266338
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWIPGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
EMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgagctg
gaaaagcaagtcctgaccgctgaggcagtcgagtttttgacggagttagtcacccgtttt
acgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcagatt
cgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaacgt
aaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcggtg
aacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgcggtctacatctgccagaaaaacatgttacctggcgg
ggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactacaaa
gcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctggcag
gaggcagcctggtggagtgaagttttcagctacgccgaagaccgcttcaatctaccgcgc
ggtacgatcaaagcgaccctgttgattgaaacgctgcctgctgttttccagatggatgag
attcttcatgcgttgcgtgatcatatcgtcggtctcaactgtggtcgctgggattatatt
ttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcctgccggacaggcaggtg
gtaacgatggacaaaccgtttctgagtgcctactcgcgcctgctgatcaaaacctgtcac
aagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgttgaa
cgcaataatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaacggc
cacgacggcacgtggattgcgcatcccgggttggcggatacggcaatggccgtctttaac
gaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccgatt
accgctgagcagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgcgcc
aatattcgcgtggcagtgcagtacattgaagcgtggatccccggcaatggctgtgtaccg
atttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttccgc
gaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctacagc
agcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacatcagatgactta
atcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system