KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000070Help
Entry
SPYALAB49_000070  CDS       T02019                                 

Gene name
adhA
Definition
alcohol dehydrogenase 1 (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPYALAB49_000070 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPYALAB49_000070 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SPYALAB49_000070 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPYALAB49_000070 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPYALAB49_000070 (adhA)
   00626 Naphthalene degradation
    SPYALAB49_000070 (adhA)
Enzymes [BR:stz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPYALAB49_000070 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61502..62518
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgagcatgatctt
ccaaatgttggtcatggtgaagcgcttgttaaagtagaatactgtggcgtttgtcatact
gatttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaa
ggtattggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgt
gtctctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgt
gagacactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaa
tatgcagtagtaacagctgattatgcagttaaagttccagaaggtttagacccagctcaa
gcttcttccattacttgtgctggtgtaacaacttataaagctattaaagaggcaggtgct
gctccaggccaatggattgttatctttggggcaggtggccttggaaatctggctgttcaa
tacgctaaaaaagtctttaatgcacatgttgtcgcagtggacattaataatgataaactt
gagttagctaaagaagttggcgcagatattgtagttaacggcaaagaaattgaagatgtt
ccaggctatattcaagaaaaaaccggtggagcacatggtgttgtggtaacggctgtttct
aaagttgcttttaaccaagcaattgatagtgtccgtgccggtgggacagttgtagccgta
ggtcttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgttccggttgtcgaaaaagttccagttgacactgctccagaagtcttt
gatgaaatggaacgtggtttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system