KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000116Help
Entry
SPYALAB49_000116  CDS       T02019                                 

Definition
GHMP kinase N terminal domain protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:stz00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87255..87521
Genome map
AA seq 88 aa AA seqDB search
MEKRIPMCAGMGGGSSDAVTIRALNQLWLLTLSRKDMMDIGIPIGSDVPYCLLSGCAQVT
GKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagcggattcccatgtgtgctggtatgggagggggttctagcgatgctgttact
atcagagcattaaatcagctatggctccttactcttagccgaaaagatatgatggatatt
ggtataccgattggtagtgatgtgccttattgcttgctttcaggttgtgcccaagtcact
ggtaaaggtgaagtggtttgtcgcattttggggctgttatcgtcttgggtggttttggtt
aaaccagattttggtatctcgacttga

DBGET integrated database retrieval system