KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000117Help
Entry
SPYALAB49_000117  CDS       T02019                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPYALAB49_000117
Enzymes [BR:stz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SPYALAB49_000117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87576..87788
Genome map
AA seq 70 aa AA seqDB search
MVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKTLQAGAATTLMTGSGPTVFAL
CQTEKQTIIV
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggcgattgaagcgggtaactataatgatgggatattgactgaaatgaacaat
ttgctggaagatattttcattgccaagcgaccctttattcaaaaaataaaagagaaaaca
ctgcaagctggtgctgctactactttgatgacaggaagtggaccgactgtttttgctttg
tgccagaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system