KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000117Help
Entry
SPYALAB49_000117  CDS       T02019                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00900  Terpenoid backbone biosynthesis
stz01100  Metabolic pathways
stz01110  Biosynthesis of secondary metabolites
stz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPYALAB49_000117
Enzymes [BR:stz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SPYALAB49_000117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEQ23729
Position
87576..87788
Genome map
AA seq 70 aa AA seqDB search
MVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKTLQAGAATTLMTGSGPTVFAL
CQTEKQTIIV
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggcgattgaagcgggtaactataatgatgggatattgactgaaatgaacaat
ttgctggaagatattttcattgccaagcgaccctttattcaaaaaataaaagagaaaaca
ctgcaagctggtgctgctactactttgatgacaggaagtggaccgactgtttttgctttg
tgccagaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system