KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000450Help
Entry
SPYALAB49_000450  CDS       T02019                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:stz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
413236..414063
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTLPGQIIQSVGRRGKYL
LIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAK
SQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLW
AAKVHPGTASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVY
GQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggtccgacgagggcttgagactttagtgcttggc
caagaaattgtggctgttacgcttaaagtgccaaagatggttaaaaccgacttagagacg
tttgccctgaccctacctggtcaaatcattcagtcagttggccgtcggggaaaatattta
ttaattgatttggggcaattagtgttggtatcacatttgcggatggaaggcaaatatttg
ctttttccagatgaggtccctgataacaaacactttcatgtcttttttgaattgaaaaat
ggttcgaccttggtttaccaagatgtgcgtaaatttggaacctttgatttgatagcaaaa
tctcaattatcagcgttttttgccaaacgaaaactaggccctgaaccaaagaaagagacc
tttaagttaaaaacctttgaggctgctctgctatcctcccaaaaacccataaaaccacat
ctgttagaccagaccttggttgctggtttagggaatatttatgtggacgaggtactttgg
gctgctaaggttcatccaggaactgcgtcttctaggttgaataaggcggagataaaacgg
ctgcatgatgaaaccatacgaatcctagctttaggaattgaaaagggcggttcgaccgtc
cgtacttaccgtaatgctttgggagctgatggcaccatgcaggactatttgcaggtttat
ggtcaaactgggaaaccgtgtcctcgttgtggacaggctattgtcaaattaaaagttgga
ggaagggggacgcacatttgtccaaaatgccagaaaaaaagaccatga

DBGET integrated database retrieval system