KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000473Help
Entry
SPYALAB49_000473  CDS       T02019                                 

Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPYALAB49_000473
   00630 Glyoxylate and dicarboxylate metabolism
    SPYALAB49_000473
   00640 Propanoate metabolism
    SPYALAB49_000473
   00650 Butanoate metabolism
    SPYALAB49_000473
  Lipid metabolism
   00071 Fatty acid degradation
    SPYALAB49_000473
   00072 Synthesis and degradation of ketone bodies
    SPYALAB49_000473
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPYALAB49_000473
   00310 Lysine degradation
    SPYALAB49_000473
   00380 Tryptophan metabolism
    SPYALAB49_000473
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPYALAB49_000473
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPYALAB49_000473
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPYALAB49_000473
Enzymes [BR:stz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPYALAB49_000473
Exosome [BR:stz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPYALAB49_000473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
437089..438237
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNAVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGPYKVAQFSPDTNSPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASRCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGHYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaacgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaatgctgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggcccttacaaagttgcccagttttctccggacacc
aacagtccatttgcgatgattgagggggcagaacgagtggcaagagaacatggctttact
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagtcgttgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaagatcacgtg
attagtgcagccaatgcctgcctcacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtttatttgaaacc
cattacccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacactatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system