KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000534Help
Entry
SPYALAB49_000534  CDS       T02019                                 

Definition
glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPYALAB49_000534
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPYALAB49_000534
Enzymes [BR:stz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPYALAB49_000534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(494442..494921)
Genome map
AA seq 159 aa AA seqDB search
MPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQALQALYDTYHDKGFEVL
DFPCNQFLNQTPGEAEEINRFCSFTYHTTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGK
RIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctctatgattttacggttaaggctcaggacggcagtgacatctcactagtt
aactacaaagaaaaagtggttttggtcgtgaatacagctaccaaatgtggactaacccca
caataccaggccttgcaagcgctatatgacacataccatgacaagggatttgaggtctta
gattttccttgcaaccaatttctaaatcaaactccaggggaagccgaagagattaatcga
ttttgcagcttcacctatcacactactttccctcgctttgcaaaaatcaaagtaaatggt
aaagacgctgatcctttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaa
cgcatcgaatggaatttcactaaatttctcattgaccaaaatggtcaagtcattaaacgc
tattcctcaaagacagatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system