KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000534Help
Entry
SPYALAB49_000534  CDS       T02019                                 

Definition
glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:stz00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:stz00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(494442..494921)
Genome map
AA seq 159 aa AA seqDB search
MPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQALQALYDTYHDKGFEVL
DFPCNQFLNQTPGEAEEINRFCSFTYHTTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGK
RIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctctatgattttacggttaaggctcaggacggcagtgacatctcactagtt
aactacaaagaaaaagtggttttggtcgtgaatacagctaccaaatgtggactaacccca
caataccaggccttgcaagcgctatatgacacataccatgacaagggatttgaggtctta
gattttccttgcaaccaatttctaaatcaaactccaggggaagccgaagagattaatcga
ttttgcagcttcacctatcacactactttccctcgctttgcaaaaatcaaagtaaatggt
aaagacgctgatcctttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaa
cgcatcgaatggaatttcactaaatttctcattgaccaaaatggtcaagtcattaaacgc
tattcctcaaagacagatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system