KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000540Help
Entry
SPYALAB49_000540  CDS       T02019                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPYALAB49_000540 (tpiA)
   01230 Biosynthesis of amino acids
    SPYALAB49_000540 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPYALAB49_000540 (tpiA)
   00051 Fructose and mannose metabolism
    SPYALAB49_000540 (tpiA)
   00562 Inositol phosphate metabolism
    SPYALAB49_000540 (tpiA)
Enzymes [BR:stz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPYALAB49_000540 (tpiA)
Exosome [BR:stz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPYALAB49_000540 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPYALAB49_000540 (tpiA)
  Exosomal proteins of melanoma cells
   SPYALAB49_000540 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
502905..503663
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSAL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagctctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgacgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggcgcatcacttgaa
gctgatagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system