KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000540Help
Entry
SPYALAB49_000540  CDS       T02019                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00010  Glycolysis / Gluconeogenesis
stz00051  Fructose and mannose metabolism
stz00562  Inositol phosphate metabolism
stz01100  Metabolic pathways
stz01110  Biosynthesis of secondary metabolites
stz01120  Microbial metabolism in diverse environments
stz01130  Biosynthesis of antibiotics
stz01200  Carbon metabolism
stz01230  Biosynthesis of amino acids
Module
stz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPYALAB49_000540 (tpiA)
   00051 Fructose and mannose metabolism
    SPYALAB49_000540 (tpiA)
   00562 Inositol phosphate metabolism
    SPYALAB49_000540 (tpiA)
Enzymes [BR:stz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPYALAB49_000540 (tpiA)
Exosome [BR:stz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPYALAB49_000540 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPYALAB49_000540 (tpiA)
  Exosomal proteins of melanoma cells
   SPYALAB49_000540 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEQ24144
Position
502905..503663
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSAL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagctctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgacgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggcgcatcacttgaa
gctgatagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system