KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000715Help
Entry
SPYALAB49_000715  CDS       T02019                                 

Gene name
dhfR
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPYALAB49_000715 (dhfR)
   00670 One carbon pool by folate
    SPYALAB49_000715 (dhfR)
Enzymes [BR:stz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPYALAB49_000715 (dhfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691097..691594
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGVAGKLPWYLPKELEHFKKTTLHQAILMGRVTFEGMNCKRLPQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQDKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPKLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtgttgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcaatcttaatgggccgtgtgacttttgaaggaatgaattgcaaaagacttcctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggataaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttatttcgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgaccaaaactagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system