KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001076Help
Entry
SPYALAB49_001076  CDS       T02019                                 

Definition
6-phospho-beta-glucosidase gmuD (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPYALAB49_001076
Enzymes [BR:stz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPYALAB49_001076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040950..1042350)
Genome map
AA seq 466 aa AA seqDB search
MKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHHQIGPEKTS
TFYENYKGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQDIIAQGIKL
IVNLYHFDLPYALQEKGGWENKATVWAYETYAKTCFELFSDLVNTWITFNEPIVPVECGY
LGYYHYPCKVDAKAAVQVAYNTQLASSLAVKACHKLHPDHKISIVLNMTPAYPRSNAPED
VKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEIIKNNTVDFLGVN
YYQPLRVQAPSKSQQEGDPLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDIALNLKEHY
GNIEWLVTENGMGVKGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaaaacaccgttatcaatttccagatggctttttatggggaagttccaca
tctgggcctcaaagcgaaggaacggttcctggagatggcaaaggacctagcaactgggat
tactggtttagtattgagtcagctaagtttcatcaccaaattggtccagaaaaaacctca
accttttatgaaaactataagggtgacattgcccttttgaaagaaacaggccacacgatt
tttcggacctcaatccagtggtctcgattgattccagaaggagtcggggaggttaatcca
aaggcggtgacattttaccgagaagtatttcaagacattattgctcaaggtattaaattg
attgttaacctctatcattttgacctcccctatgccttgcaagaaaaaggtggctgggaa
aacaaagctactgtctgggcttatgaaacctacgcaaaaacctgttttgagctttttagt
gatttagtaaacacttggattacctttaatgaaccgattgttccagtcgaatgtggctat
ttaggttattatcactacccttgtaaagtagatgccaaggcagcagttcaagtggcttac
aacacacaactggccagttcactggcggtcaaagcttgtcataagcttcatcccgaccac
aagattagtattgtgcttaacatgacacctgcttatcctcggagtaatgctcctgaagat
gtcaaggctgctagaatcgcagagcttttccaaaccaaatccttcctagatccatcagtt
ttgggtgtttacccagcagagttagtttccattttagaggaagctgatttattacctcaa
tatagtgctgatgaattagagattatcaaaaacaatactgttgattttttgggagttaat
tattatcagcctttgcgggttcaggcacctagtaagtcacagcaagagggggaccccctt
atcttagatatttattttgaaccttatgatatgcctggtaaaaaagtcaatcctcaccgg
ggttgggaaatttatgaaccaggactttatgatattgctcttaatttaaaagaacactat
ggtaacatcgaatggctagtcacggaaaatggtatgggtgtcaaaggtgaagaagctttt
ttagcagatggccagatacaagatgactaccgcatcacctttatcgaggatcatcttatc
cagcttcataaggctttgggagaaggagccaactgcaaaggctacctcttgtggactttt
attgattgctggtcttggttaaatgcttataaaaaccgatatggtttggtagctttggat
ttagagagtcaaaagcgaaccataaaaaaatcaggttactggtttaaggcgttgagcgag
tcaaatggttttgataaatag

DBGET integrated database retrieval system