KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001414Help
Entry
SPYALAB49_001414  CDS       T02019                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPYALAB49_001414 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPYALAB49_001414 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPYALAB49_001414 (proB)
Enzymes [BR:stz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPYALAB49_001414 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1356802..1357620)
Genome map
AA seq 272 aa AA seqDB search
MKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAMGFG
LDILKMEKRPINLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPESLAN
VTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLSDID
GLFDKNPTIYEDAQLRSHVTVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKGQMV
LMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcactagttcatta
gtgctaccaacaggtaaaatcaatttagaaaaaatcgaccaactggcttttgtgatttca
agtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatgggatttgga
ctagatattttgaaaatggaaaaacgtccgatcaatcttgctaaacaacaggcagtttcc
agtgttggtcaggtggccatgatgagtctttattcacaaatttttgcacactaccaaacc
aacgtgtcgcaaattttattgacgagagatgttgtagttttcccagaaagtctagcgaat
gttaccaatgcttttgaaagtctgattagtttgggcattgtgcctattgttaatgaaaac
gatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataatgaccgttta
tctgctgtcgtagcaggtattacaaaagctgatttattaatcatgttgtctgatattgat
ggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagccatgttacg
gtcattacgcaagaaatcattgcttcagcaggtggtgcgggcagtaagtttggcacaggt
gggatgcttagcaaaattcaatctgcccagatggtatttgaaaacaaaggacagatggtc
ttaatgaatggagctaatcccagagatattttaagggtgcttgaagggcaaccactaggc
acatggtttaaacaaatagaagaggtaaggcatgactga

DBGET integrated database retrieval system