KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001414Help
Entry
SPYALAB49_001414  CDS       T02019                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00330  Arginine and proline metabolism
stz00332  Carbapenem biosynthesis
stz01100  Metabolic pathways
stz01130  Biosynthesis of antibiotics
stz01230  Biosynthesis of amino acids
Module
stz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPYALAB49_001414 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPYALAB49_001414 (proB)
Enzymes [BR:stz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPYALAB49_001414 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AEQ24993
Position
complement(1356802..1357620)
Genome map
AA seq 272 aa AA seqDB search
MKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAMGFG
LDILKMEKRPINLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPESLAN
VTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLSDID
GLFDKNPTIYEDAQLRSHVTVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKGQMV
LMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcactagttcatta
gtgctaccaacaggtaaaatcaatttagaaaaaatcgaccaactggcttttgtgatttca
agtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatgggatttgga
ctagatattttgaaaatggaaaaacgtccgatcaatcttgctaaacaacaggcagtttcc
agtgttggtcaggtggccatgatgagtctttattcacaaatttttgcacactaccaaacc
aacgtgtcgcaaattttattgacgagagatgttgtagttttcccagaaagtctagcgaat
gttaccaatgcttttgaaagtctgattagtttgggcattgtgcctattgttaatgaaaac
gatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataatgaccgttta
tctgctgtcgtagcaggtattacaaaagctgatttattaatcatgttgtctgatattgat
ggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagccatgttacg
gtcattacgcaagaaatcattgcttcagcaggtggtgcgggcagtaagtttggcacaggt
gggatgcttagcaaaattcaatctgcccagatggtatttgaaaacaaaggacagatggtc
ttaatgaatggagctaatcccagagatattttaagggtgcttgaagggcaaccactaggc
acatggtttaaacaaatagaagaggtaaggcatgactga

DBGET integrated database retrieval system