KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001785Help
Entry
SPYALAB49_001785  CDS       T02019                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1742863..1743459)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGHTKARSNKAGNTQLDEAIEALLALGYKAKELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacagatagtgtc
aaccaattggtaaccatttatctgcatcaagtgattcgtgaggatgctcacctgttgttt
ggttttcacacggaagatgaaaaagatgtttttctgaaattaatttctgtatcaggtatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtcat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttataaagcaaaagagctgaaaaaaattcgtgccttctttgaggggacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system