KEGG   Sulfurimonas autotrophica: Saut_0068Help
Entry
Saut_0068         CDS       T01316                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sua  Sulfurimonas autotrophica
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sua02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sua02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(70637..74962)
Genome map
AA seq 1441 aa AA seqDB search
MKDSVFIGIGASAGGLEALKELLPLLPQDEGYVYIIAQHLDPHKKSALGEILTAYTAMPV
VTISQKYTFLPNSVNIVPPGYNLTYAKHKLLLEKISKTPHTPTPSVDELFKALSSYKKEN
CVGIVLSGAGHDATAGVKTIKENGGITVAQSPDEAQYADMPKNAIQSGYIDYVLKVAQIG
ENLESIIHIMPEPLMKITKLLEEKECLDIDKYKKETIMRRLNKRMMLTKCADLDEYFDYI
QTHPDELYLLYQNILIGVTEFFRDKESFEVFKQHLEHYLLDKPDHYDLRIWSIACSTGEE
AYSLAIIIDQIKKKLKKNFSVHIFATDIDEKALEIAKKGIYTKKLLEKIDKKIIKTYFSA
LDEGYKIKEFIRSQIVFTKHNILSDPPFIKQDIISCRNFLIYILPEVQQELFVLFHYALK
DKGLLFLGSSESTLMSVDYFKALNQEHKVYVKEALQNPPRISSHYFSSHINTKQNQTGIK
TSTLKDINIKEEITNTVFELFSHECIIVDTNFTIVYKQGSNPFLELGDGFVTLNIVENLK
KELRYSVKKILKRTLKTATLHSTKFIEVKLDNKEQTFVKVIAAPFANKQNTPFILLYFQE
LNAHGLEFDTREIVLPNESYVVENLTNRVKELQEDYHALLDELSISKENMQLLNEELQRS
NEELQSANEELETSNEELQSSNEELQVSIINEQKLQRQLALILNSTHDGIMGLDLEGRHT
FVNAAALEMLGYTKDELLGKNAHRIWHHTKPDGSHYLFSECTLHTHLVDGLSVRKEDFFF
KKDSTGFNVEVLQNPIIEEGKVKGAVLSFRDITEKKKLQQEAEYEHRLANLYVNTTGTLV
MVLDLAGSVNMINNSGCELLGLPKEKIIGKNFIHNFIPKARQPENQNVFDSLISEKTDIL
KEYKNIIIDAQGKEHIISWRNNYIKDDNGTLTSLLSSGIDITDKEALTEKLFEQEHLYKL
TFEEADIGIAHVSLDGRWIDTNEYLSKLLGYTKEEFQNMHVFDITFPQDRDTDMHMIEQL
HKGEKKSYHIEKRYVHKNGNIIWVSLAVVLLLDEQKKPLYLLKIIRDISQLKLLMYQIEI
EKNRFQRIIEFTPIPTMLYNTDGDILILNKIFQDNTGYTLEEIPTIDKMVEKLFVNEDAD
SIKSIKQYYKEPTKLPKQQQCITTKSKERRVGILDAVKLDEEGNSSEILYLIAIVDITDI
QKKDELMVAQSRQAAMGDMLSMIAHQWRQPLSVISMVANNIQAQIELQRSVDAKSLHDLI
HTLNEQTQYLSHTIDDFRNFFKPDKNREFIKIDVILEKLTHLIEKSLQNNAISLTLPKKS
DIELCTYQNQLLQVLINIINNAKDAIKEHRAQDGNISIDVIKKKKEILLKICDNGGGIKP
EILKKLGEPYVTSKSKNGTGLGIYMSRIIVEKHLGGRLSWESNSKGSCFYISLPKDTICE
S
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattctgtatttatcggcataggtgcaagtgccggagggttagaagccttaaaa
gagctattgccgctgttgccgcaagacgaaggttatgtttacatcattgcacagcacctt
gacccgcataaaaaaagtgccttaggtgaaattttgacagcatacactgctatgccggta
gttacaatttcccaaaaatacacgttcctgccaaacagtgtaaatattgttcctcccgga
tacaatctgacatatgccaaacataaactgctgcttgaaaaaatttcaaaaaccccgcat
acacccacaccctctgttgatgaactcttcaaagcactcagcagttataaaaaagaaaac
tgtgtaggcatagttctcagcggtgcaggacatgacgcaacagcaggtgtcaaaaccatt
aaagaaaacggcggtatcaccgttgcacagtccccagatgaagcacaatatgccgatatg
cctaaaaatgccatacaaagcggctatattgactatgtgcttaaggtagcacagattggt
gaaaaccttgagagcattatacatataatgcccgagcctttgatgaagattacaaaactt
cttgaagaaaaagagtgtctcgacatcgacaaatacaaaaaagagaccattatgcggcgg
ttgaacaaacgtatgatgcttaccaaatgtgcggatctcgacgagtattttgattatatt
cagacacatcctgatgaactttacctgctgtatcaaaatattttaatcggagtgacagag
tttttcagagataaagaatcttttgaagtattcaagcagcatcttgagcattatctcttg
gacaagcctgatcattatgacttgagaatctggtctattgcctgttctaccggtgaagag
gcttactctttggctatcatcattgatcaaatcaaaaaaaagctcaagaaaaacttcagt
gttcatatttttgccactgacattgatgaaaaagcacttgagattgcaaaaaagggtata
tacacaaaaaaattacttgaaaaaatagataaaaaaattattaaaacctatttcagcgca
ctggatgagggatacaaaataaaagaatttatacgctcacagattgtttttaccaaacac
aatattttaagtgacccgccttttatcaagcaggatatcatcagctgcagaaattttctc
atctatatcttgccagaagtccagcaggagctttttgtgctctttcattatgcgctcaaa
gacaaagggctgctctttttgggttcatcggaatctacactcatgagtgtagattatttt
aaagccttaaatcaggaacataaggtctatgtcaaagaagcactgcagaatccgccgaga
atatcttcgcattacttttcctcacatataaatacaaaacaaaaccagacaggaataaaa
acatctacactcaaagacataaatataaaagaggaaataacaaacaccgtctttgaactc
ttttctcacgaatgtattatagttgatacaaattttactattgtttataagcaggggagc
aatccttttttagaactgggtgatggttttgtgactttaaatattgttgaaaatctgaaa
aaagagcttcgatacagtgtaaaaaagattctcaaacgaactctcaaaacagcgacactt
cacagtacaaaatttattgaagtcaaactcgataataaagaacagacctttgtcaaagtt
attgccgccccttttgcaaacaaacaaaacactccgtttattttgctctattttcaggag
ttaaatgcacatggtctggagtttgacactcgcgaaattgtactgccaaatgaatcttat
gtcgttgaaaaccttacaaaccgggtaaaagagctccaagaggactaccatgctcttttg
gatgagttgagtatatcaaaagagaatatgcagctgctcaacgaagagctgcaaagatcc
aatgaagagctccaaagtgccaacgaagagcttgagacatccaatgaagagctccaaagc
tcaaacgaagaactccaggtctccatcatcaatgaacaaaaactgcaaagacaacttgca
ttgatactcaactccacccatgacggcatcatgggtcttgatcttgagggaaggcatact
tttgtcaatgcagccgcacttgaaatgctgggctataccaaagatgagcttttgggcaaa
aatgcccatagaatctggcatcacacaaaaccggacggcagtcattatctttttagtgaa
tgtactttgcatactcatcttgttgacggtctttccgtgcgaaaagaagatttctttttc
aaaaaagacagtacaggttttaatgtagaagtattgcaaaacccgattatagaagagggt
aaagtaaaaggagccgtgctctcttttcgtgatattacagagaagaaaaagctgcaacaa
gaggctgagtatgagcacaggcttgccaatttatatgtcaatacaacaggcactcttgta
atggttttggatttagcaggcagtgtcaacatgataaacaacagcggctgcgagctgctg
ggactgccaaaagaaaaaattatcggcaaaaattttatacacaatttcataccaaaagca
agacagccggaaaaccaaaatgtttttgactcacttattagtgaaaaaacagatatttta
aaagagtacaaaaacatcatcattgatgcacagggcaaagagcatatcatttcatggaga
aacaactacattaaagatgacaacggcacacttacttctcttttgagttccggcattgac
atcaccgacaaagaagcactcacagaaaaacttttcgagcaggaacatctttacaaactg
acctttgaagaagcagacattggtatagctcatgtctctcttgatggcagatggatagac
accaacgaatacctctcaaaacttttaggatatacaaaagaagagtttcaaaatatgcat
gttttcgacattaccttcccccaggacagagataccgacatgcatatgatagagcaactg
cataaaggagaaaaaaagtcttatcatatcgaaaaacgctatgtgcataaaaacggcaat
atcatctgggtgagtctggctgtcgtacttttacttgatgagcagaaaaaaccgctctac
ttactgaaaataatccgtgacatatcacaactcaagcttttaatgtaccagatagagatt
gaaaaaaacagatttcaaagaatcatagagtttacgccgattccgactatgctttacaac
acagacggagatattttaatacttaacaaaattttccaggacaacacaggctataccctg
gaagaaatcccgacaattgacaaaatggtggaaaaactttttgtcaatgaagatgcagac
agtataaaaagtataaagcagtactacaaagagcctacaaaactgccaaaacagcaacaa
tgcattaccacaaaatcaaaagagagaagagtcggaattcttgatgccgttaagctcgat
gaggagggcaacagtagtgaaattttatatcttatcgcaatagttgatataaccgatata
caaaaaaaagatgaactcatggtcgcacaatcccgccaggctgcaatgggagatatgctc
tcaatgatagcccatcaatggagacagcctttgagtgttatttctatggtcgcaaacaat
attcaagcacaaatagaactgcagagaagtgttgatgcaaaatctctgcacgatctcata
catacgctcaatgagcaaacgcaatatctctcacacaccatagatgattttagaaatttt
ttcaaacctgacaaaaatagagagtttattaaaatagatgtcattttagaaaaacttacc
catctgattgaaaaatctttacagaataatgcaatcagtttaacactgcctaaaaaaagc
gatattgagttatgcacgtatcaaaatcaactgctgcaggtgcttataaatataattaac
aatgccaaagatgccatcaaagagcacagagcacaagacggaaatatcagcatagatgtt
ataaaaaagaaaaaagagattctcttgaaaatttgcgacaacggcggaggcataaaaccc
gaaatactcaaaaaactcggagagccttatgtgacatcaaaatctaaaaatggcacaggt
ttaggcatatatatgtcaagaataattgtagaaaaacatcttggcggcagactctcctgg
gagagtaacagtaaaggaagctgtttttatatttcactgcccaaagacacaatctgtgag
tcataa

DBGET integrated database retrieval system