KEGG   Sulfurimonas autotrophica: Saut_0297Help
Entry
Saut_0297         CDS       T01316                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sua  Sulfurimonas autotrophica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Saut_0297
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Saut_0297
Enzymes [BR:sua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Saut_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273685..274980
Genome map
AA seq 431 aa AA seqDB search
MKIELPDQAYKYVTENSGECDEETAFVLTHQNRAYLEDAKQHNAHSIIKIEDIAELFGVN
KIKIIGITGTNGKTTTASAIYSFLLDLGYKAALQGTRGLFMNDEVCEGKTLTTPSVLNTY
KHIYQAVCAGCEYFIMEVSSHALVQRRIEGLKFELKILTNITQDHLDYHKTIEEYIAVKN
GFFQDESKKLINKDEPKAAFNFKNAYTYGIENPATYRLMAYSLNEGSSGIIQHFQEIVPF
TASLHGFFNLYNLMAAIAATHLITDKTLEEIADVVDNFAGVSGRMEQVCAAPNVIVDFAH
TPDGMQQVLNALKEKELIVVFGAGGDRDRLKRPIMGRVAASLAKKVIVTSDNPRHEDPEI
IIDDILEGIQDKTNIIVELNRKKAIQMALDMQEDEEVVVILGKGDEAYQVIYDEKFAFDD
REVVKELLNLS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattgaattaccagaccaggcttataaatacgtaacagaaaactctggggagtgt
gatgaagaaacagcttttgtattgacacatcaaaacagagcctatttggaagatgcaaaa
caacataatgcgcactctattattaaaatagaagacatcgcagaactttttggtgtcaat
aaaattaagattattggtattactggtacaaacggtaaaactactacagcaagtgcaatc
tattcatttttacttgatttaggctataaagctgctctgcaggggacgcgtggccttttt
atgaatgatgaagtgtgtgagggtaaaactctgacgacgccttctgtgcttaatacctat
aaacatatttatcaggcagtatgtgcgggatgtgaatattttatcatggaagtaagttca
catgccttggtgcaacgaagaattgaaggtctgaagtttgaattaaaaattttgacaaat
attacgcaagaccatttggattatcataaaactatagaagaatatatagcagtaaaaaat
ggtttctttcaagatgaaagcaaaaaactcatcaataaagatgaaccaaaggccgcattt
aattttaaaaatgcctacacatatggtattgagaatcctgctacatacagactgatggca
tactcactcaatgaaggttcaagcggtattatccagcattttcaagaaattgttcctttt
accgcatctcttcatggttttttcaacctctataatctcatggcagcaatagcagcaacg
caccttataacagataaaaccttagaagaaatagcagacgttgtcgataattttgcagga
gtcagcggaagaatggaacaggtctgtgcggcaccgaatgttatagtggactttgcgcat
acgccagacggtatgcaacaggtactcaatgccctaaaagaaaaagagctcattgttgtc
tttggtgcaggcggagacagagacagactaaagcgtcctattatgggcagggtagctgca
agtcttgctaaaaaagtgattgttacaagtgataatccgcgtcatgaagatcccgagatt
atcatagatgatattttagaaggtattcaagataaaacaaatatcatagttgagctcaat
agaaaaaaagcaatacaaatggcacttgatatgcaagaagatgaagaggttgttgtaata
cttggaaaaggtgatgaagcatatcaggttatttatgatgagaagtttgcttttgatgac
agagaggtagttaaagagttattaaatttgagttaa

DBGET integrated database retrieval system