KEGG   Sulfurimonas autotrophica: Saut_0327Help
Entry
Saut_0327         CDS       T01316                                 

Definition
pantothenate synthetase (EC:6.3.2.1)
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sua00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:sua00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305788..306609
Genome map
AA seq 273 aa AA seqDB search
MKIISNPLVLKQHLKDIDKTAGFVPTMGALHEGHIALIKHAKEENEVVVVSIFVNPTQFL
AGEDLDKYPTKDEADKKICELAGVDILFFPNAQEIYSQDEVKICAPNVRGYVLEGATRPG
HFSGVLRVVMKLLNIVSPTRAYFGKKDAQQLNLISLMVKQFFMSVEIVPVDIVRDSDGLA
LSSRNVYLSKEQRKEALKIPKSLYAASKLISKNILNTEKIKEEIYAILAPLETEYVEVLS
RDFEVIDEVQIGNSIILVEVIVGETRLLDNIWL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagattatatcaaatcctttggtgttaaaacaacatttaaaagatattgacaaaacg
gcggggtttgtacctacgatgggtgctttgcatgaagggcacattgcacttataaaacat
gccaaagaagaaaatgaagtggtggtggtttctatctttgtcaatcctacgcaatttttg
gcaggtgaagatttagacaaatacccaacaaaagatgaagccgataaaaaaatatgcgaa
ttagcaggagtggatatactcttttttccaaatgcacaagaaatatacagtcaagatgaa
gtaaaaatctgcgcacccaatgtaagaggctacgtacttgaaggagcgacaaggccgggg
catttcagcggtgttttgagagttgtaatgaaactgctcaatattgtctctcctacaagg
gcctactttggaaaaaaagacgcacagcagctcaatcttataagtttgatggtaaaacag
ttttttatgagcgttgaaattgtaccagtggatattgtgcgcgacagtgacggtttggca
ctgagcagtagaaatgtttatctttcaaaagaacaaagaaaagaagcattgaaaattcca
aagtctttatatgcagcatctaaacttatcagtaaaaatattttaaatacagaaaaaatc
aaagaggaaatatatgctattttagcaccattggaaacagaatatgtagaagtactaagc
cgtgattttgaagtgatagatgaagtgcaaattggtaacagcatcatactcgtcgaggtc
attgtcggcgaaacaaggttacttgacaatatttggctctaa

DBGET integrated database retrieval system