KEGG   Sulfurimonas autotrophica: Saut_0353Help
Entry
Saut_0353         CDS       T01316                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sua  Sulfurimonas autotrophica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saut_0353
Enzymes [BR:sua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Saut_0353
Exosome [BR:sua04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saut_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330666..331643
Genome map
AA seq 325 aa AA seqDB search
MFQRFRRTRLNKHLRALVRETHVSTDDFIYPLFVRSGEDIKTEVASMPGVYQMSIDVAVK
ECQELKELGIYSIILFGIPDVKDSIGSDALCEHGIIASAVREIKKAHPDMFVVTDLCFCE
YTDHGHCGIIDEVHETVDNDATLEISGQQAIVHAKAGADMIAPSGMMDGIIQTVRTSLDN
AGYKDLPIMSYSTKFASGYYGPFRDVAESTPSFGDRASYQMDPANRREAIAESISDEAQG
ADILMVKPALAYLDIVREIKDNTSLPMAVYNVSGEYAMLKFAGMNDLIDYERVVMETMIA
FKRAGADIIISYHAKEVAKMLNNNR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaagatttcgtagaactcgtttaaataaacatcttcgtgcgcttgtgcgagaa
acacatgtaagtacagatgattttatctacccgcttttcgtacgcagtggagaagatatt
aaaacagaggttgcttctatgcccggtgtatatcagatgagcatagatgtggctgtaaaa
gagtgtcaagagttaaaagagctgggtatttactctattattctatttggtattcctgat
gtaaaagattctataggcagtgatgctttatgtgaacacggcattattgcttcagcagta
cgtgaaataaaaaaagcacacccggatatgtttgttgtgacggacttgtgtttttgcgag
tatactgatcatggacattgtggcattatcgatgaagtgcatgaaacggttgataatgat
gcaaccctggagatttcaggacagcaggcaattgtacatgcaaaagcaggagctgatatg
atagctccttctgggatgatggacggtatcatacaaacagtgcgtacatcactggataat
gcagggtataaagatctgccgattatgtcatactctacaaaatttgcaagcggttactac
ggtccgtttcgtgatgtggctgaatcgacgcctagttttggagaccgtgcatcgtatcaa
atggacccggcaaaccgtcgtgaagcgattgcagaaagcattagtgatgaagcgcagggc
gctgatattttaatggtaaaaccggcccttgcttatttggacattgtgcgagagataaaa
gacaatacaagcctgccgatggctgtgtataacgtgagcggtgagtatgctatgcttaaa
tttgcagggatgaacgatttaattgattatgaacgtgtagttatggagacgatgatagca
tttaagcgtgcgggtgctgacataatcatttcatatcatgcaaaagaagttgccaaaatg
ttgaacaacaatcgctaa

DBGET integrated database retrieval system