KEGG   Sulfurimonas autotrophica: Saut_0376Help
Entry
Saut_0376         CDS       T01316                                 

Definition
AAA ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sua  Sulfurimonas autotrophica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sua00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Saut_0376
Enzymes [BR:sua01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Saut_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353335..355569
Genome map
AA seq 744 aa AA seqDB search
MTLIGQIDRILFESEGFFIAVLKSGEKISGTYFESDVASIKDAAITLEGEWVEHKKYGKT
FKFETLKVNQNELFFFLNKIIKGFTKKLSADLIEHFGSDRLIEILDNDIEKLLEFKGIKE
KRLKKIQASWKQFRSMRRLGEFLSPYDVTPVLLTTIATAMKDVDEPCTKIKENPYILTSI
NSIGFKRADELALKMGVAPENEQRISSAMDYVLLNYCEAQGNSCIAKEVLFGGLDELLGF
VNKQNLYEAALVERVAEQSIVIMKNERVSPARLYDAEKFLYDDFTARAKLDNGGFVKDLD
AFLSESSLKLGEQQRTAAEMINNGASLLFLVGYAGTGKSTTSKTILELLNTRYDKKEIIT
CALSGIASQRISDTTGYESATIQSLLVKHEESDKFPYSVVLIDEASMINSTLFARLMRKI
SKKAIVIIVGDDAQLPPIGAGNVLSDVLSLELAPTVKLTQIYRQSEEQAITLIANQIRQA
ELPEYRQKYEDFEFVDVSIQNYYALKNQLSQDELKNLRDENSKQIITEIIHRVVASIEKA
RYRLNNKQIKEYLNYFQVITPMKGGILGTTNLNKVLQEYFNPNPKKCVKRGELEFRLMDK
VVHTKNENMASWSGEGFKEGEDTDERRIFNGMSGLLFKIDEEEEQVFVFYPNEDVVVRYE
YEELKSHLMLSYALTIHKVQGMEYDIIVIPMSFTHYIMHNTKLIYTAITRAKHKCIVIGE
GGAFENACRRVDVTRRDTVLLELK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
gtgacactcataggccaaatagacagaattctttttgaatcagagggttttttcattgcc
gttttaaaaagcggtgagaaaataagcggaacctattttgagagtgatgttgcgagcatt
aaagacgcggcaatcacgcttgagggagaatgggtcgagcataaaaaatacggcaagact
tttaaatttgagacactcaaggtcaaccagaacgaactctttttctttctcaataaaatc
atcaaaggctttacaaaaaaactctctgctgatttgatagaacacttcggctcagaccgg
ctcattgaaattttagacaatgacattgaaaaacttttagaatttaaaggtataaaagaa
aaacgcctgaaaaaaatccaggcttcatggaaacagtttcgctccatgcgccgtttgggt
gagtttttaagcccgtatgatgttacaccggtacttttgacaactattgctacggctatg
aaagacgttgatgaaccctgcacaaaaatcaaagaaaatccctatattcttacaagtata
aactccataggcttcaaacgcgcagatgaactcgcacttaaaatgggtgtagcacctgag
aatgaacagcgtatcagttcggctatggattatgtgctgttaaattattgtgaagcgcag
ggaaacagctgcattgccaaagaggtactgtttggcgggttggatgaactgcttggattt
gtgaacaaacaaaatctgtatgaagctgccttggttgagagagttgcagaacaaagcata
gtgataatgaaaaacgagcgggtttctcctgcacgtctgtatgatgcagaaaaattcttg
tatgatgactttacggctcgtgctaaacttgataacgggggatttgtcaaagatttggat
gcctttttgtctgagagttctctcaaactcggcgagcagcaaagaactgcggcggagatg
ataaataacggtgcatcactgctttttttggtcgggtatgcgggaacgggtaagagtacc
acttcaaaaacgattttagaactgctcaacacccgttatgacaaaaaagagataataacc
tgtgcgctcagtggtatagcctctcaaagaatcagtgatacgacagggtatgagagcgca
acgattcagtcgcttttggtaaaacatgaagagagtgataaatttccctactcggttgtg
cttatagatgaagcctctatgataaactctacactttttgcacgacttatgcgaaaaatc
tctaaaaaagccattgttattattgtcggtgatgacgcgcagcttcctcccataggtgcg
ggaaatgtactgagtgatgtgctgagtcttgaactcgcacctacggttaaactgacacag
atttacagacagagtgaagagcaggccattacgcttatagcaaatcagatacgccaggca
gaactccccgagtacaggcaaaaatatgaagattttgagtttgtagatgtaagcatacaa
aattattatgctctgaaaaatcaactctctcaagatgagttgaaaaacctcagggatgaa
aattcaaagcagattattacagaaattattcatcgcgttgttgcatctattgaaaaagcc
agatacagactcaacaacaaacagataaaagagtatttgaactattttcaggtgattact
cctatgaaaggcggcatactcggtacaaccaacttaaacaaggttttgcaggagtatttt
aatccgaatcccaagaagtgtgtgaaacgcggcgagttggaatttcgtcttatggacaag
gtcgtgcatactaaaaatgagaatatggcctcttggagcggggagggttttaaagagggc
gaggatactgacgagcgaagaatttttaacggtatgagcggactgttatttaaaattgat
gaggaagaggaacaggtttttgtattttatccgaatgaggatgtcgttgtgcgctatgag
tatgaagagctcaaatctcatctgatgctctcttatgcacttaccatccataaagtgcag
ggaatggagtatgatatcatagttattcctatgagttttacacattatattatgcacaat
accaagctgatatataccgccattacaagagccaaacacaaatgtatagttataggcgag
ggcggagcgtttgagaacgcctgccgacgtgttgatgttacaaggagagatacggtactt
cttgaattaaaataa

DBGET integrated database retrieval system