KEGG   Sulfurimonas autotrophica: Saut_0477Help
Entry
Saut_0477         CDS       T01316                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00010  Glycolysis / Gluconeogenesis
sua00052  Galactose metabolism
sua00500  Starch and sucrose metabolism
sua00520  Amino sugar and nucleotide sugar metabolism
sua00521  Streptomycin biosynthesis
sua01100  Metabolic pathways
sua01110  Biosynthesis of secondary metabolites
sua01120  Microbial metabolism in diverse environments
sua01130  Biosynthesis of antibiotics
sua01200  Carbon metabolism
Module
sua_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_0477
   00052 Galactose metabolism
    Saut_0477
   00500 Starch and sucrose metabolism
    Saut_0477
   00520 Amino sugar and nucleotide sugar metabolism
    Saut_0477
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Saut_0477
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Saut_0477
Enzymes [BR:sua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Saut_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADN08526
UniProt: E0UP62
Position
463224..464066
Genome map
AA seq 280 aa AA seqDB search
MKLGIDIGGTYLRYELRENDKTIKKSSLKSAQTGLCSFLEMILHEEKKISSIFIAYAGQV
NEGVILSAPNITIDKHEIKAYIEAKYNVKLFIENDLNCAVLAEAKSCKTENICAVYAGTG
LGLGVVSSSVLIKGSDNIATELGHIPYKDTPFTCNCGKHNCIELFCSGSGLLRWKEYYKL
KPELSLEQLHQSKKDEAQKIYNEFIEALLYAVGTTITLFNPKVLVIGGGLIMHNRYLHGI
IQERIKAYALPLALKNIKITISTLEDASLEGAFLLKDLYE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgggaattgatataggaggaacatatcttcgttatgaactcagagaaaatgat
aaaacaataaaaaaatcatctctaaaaagcgcacaaacaggactttgtagttttttagag
atgattttacatgaagaaaaaaagatttcaagcatttttatagcatatgccgggcaggta
aatgagggtgttattctctctgcgccaaatataaccatagataaacatgaaataaaagcc
tatatagaagctaaatataatgtaaaactttttatagagaatgatttaaactgtgcagtt
ttagcagaagcaaaaagctgtaaaacagaaaatatttgtgcagtatacgcaggaacaggc
ctggggcttggcgttgtcagttcttctgtgcttataaaaggcagtgataacattgcaaca
gaattagggcatattccttataaagacaccccctttacatgtaactgtggcaaacacaac
tgcatagaacttttttgctcaggaagcggacttttacgatggaaggagtactataaactc
aaaccggagctgagtttagaacaattacatcaaagtaagaaagatgaagcacaaaagatt
tataatgagtttattgaagctcttttgtatgcggtgggtacaaccataacgctttttaac
ccgaaagttttggtgattggaggcggattgattatgcataacagatatttacatggaatt
attcaagaaagaataaaagcgtatgctctgcctcttgctttgaaaaatataaaaattacc
atttcaacattagaagatgcctctttggagggtgcatttttattaaaggatttgtatgag
tga

DBGET integrated database retrieval system