KEGG   Sulfurimonas autotrophica: Saut_0556Help
Entry
Saut_0556         CDS       T01316                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saut_0556
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_0556
   00620 Pyruvate metabolism
    Saut_0556
   00640 Propanoate metabolism
    Saut_0556
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_0556
   00680 Methane metabolism
    Saut_0556
Enzymes [BR:sua01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saut_0556
Lipid biosynthesis proteins [BR:sua01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saut_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536018..537769
Genome map
AA seq 583 aa AA seqDB search
MQNNWIVKKKSDFLVEPNLLDYEKVYNSFKWEDVAKEFDGLPSGGLNIAHEAIDRHADSD
KADKVALLWLGEKGQKVSYTYMQMKKETAKFANVLKSLGIKKGERIYTLSPRLPELYIGA
IGILKNLSVMCPLFSQFGPGPILQRMQSGDATALLTTQKLFNKKIRPMLNELKGLKYILL
IDAEEDENEIIRSLPKLMQEASDEFEIPPTDPEDMSLLHFTSGTTGMPKGVVHVHKAIYT
HWMTGKYVLDFHEHDNYWCTADPGWVTGTSYGIITPWVHGVTNIVDESEFNANRWYEILQ
NEKVSVFYTAPTAIRRLMRIDNEPTEEYDLSHLRLIQSVGEPLNPEAVIWGVEKLKMAIH
DNWWQTETGGIMIANLISQTVRPGSMGRPLPGITAAIVRQNGDGTVTEVTEPGKDGDLAL
RPGWPSMFRAYLHNEEKYKKSFVGGWYISGDLAYKDEDGYYWFVGRADDIIKTSGHMVGP
FEVESALMEHPAVAEAGVIGKPDELIGQLVKAFVSLKHGYEPTEELKRELIGFARKKLGA
AVAPKEIEFQEKLPKTRSGKIMRRLLKAREMGLPEGDTSTLEE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataattggattgtgaaaaagaaaagtgattttttagttgaaccgaatctttta
gattatgaaaaagtctataactcttttaaatgggaagatgtagcaaaagagtttgacggt
ttgccctcaggtggattaaacatcgctcatgaagcaattgaccggcatgctgattctgat
aaagccgataaagtggctttattatggcttggagagaaagggcagaaagtaagctataca
tatatgcagatgaaaaaagagacggcgaagtttgccaatgtattaaaatcattaggcatt
aaaaaaggggaaagaatttatacactttctccgagattgccggagctttacatcggagct
ataggtatacttaaaaacctgagcgtgatgtgtcctcttttctcacagtttggtcccggt
cctatactgcagcgtatgcaaagcggtgatgcgacggctcttctaacaacccaaaaactt
tttaataaaaaaatccgtccgatgctcaatgaacttaaagggttgaaatatatactttta
atagatgccgaggaagatgaaaatgagataatacgttcacttccaaaacttatgcaagag
gcttcggacgaatttgaaattcctccaactgatcctgaggatatgtcactgctgcacttt
acaagcggaacgacaggtatgccaaaaggtgtagttcacgtgcataaagcaatatataca
cactggatgacaggcaaatatgttcttgattttcatgagcatgataactactggtgtact
gccgatccgggttgggtaacggggacctcatacggaattattactccatgggtgcatggc
gtgactaatattgttgatgaatctgaatttaatgcaaacagatggtatgagatactgcaa
aatgaaaaagtcagtgttttttatacggcaccgacagccatacgacgtttgatgagaatc
gataatgaaccgactgaggagtatgacctttctcatctgcgccttattcaaagtgttggc
gaaccgctgaatcctgaagctgttatatggggtgttgaaaaactgaaaatggctatacat
gacaactggtggcagactgaaacaggcggcataatgatagcaaacctaatatctcaaaca
gtaagaccaggctcgatgggacggcctcttcccggaataactgcggcaatcgttcgtcaa
aatggggatggaacggtaacggaggtaacagagcctggaaaagatggagatttggctctt
agacccggctggccgtctatgtttagagcgtatctgcataatgaagaaaaatataaaaaa
tcttttgtcggtggatggtatatctcaggagacttggcttataaagatgaagacgggtat
tattggtttgtcggccgtgcagatgatattataaaaacatccggacacatggtaggtcct
tttgaggttgaaagcgccctgatggagcaccctgcggttgccgaagctggagttatcggt
aaaccggatgagcttatcggacagcttgtcaaggcttttgtgtctttaaaacacgggtat
gagccgacagaagaattaaaacgggaacttattggttttgcacgcaaaaagctaggtgca
gcagtagctccaaaagagatagagtttcaagaaaagcttcctaaaacccgtagcggcaag
attatgagaagactgttaaaagcaagagaaatgggattgcctgaaggtgatacttctacc
ttggaagagtaa

DBGET integrated database retrieval system