KEGG   Sulfurimonas autotrophica: Saut_0556Help
Entry
Saut_0556         CDS       T01316                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sua01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sua00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sua00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sua00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sua00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sua00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536018..537769
Genome map
AA seq 583 aa AA seqDB search
MQNNWIVKKKSDFLVEPNLLDYEKVYNSFKWEDVAKEFDGLPSGGLNIAHEAIDRHADSD
KADKVALLWLGEKGQKVSYTYMQMKKETAKFANVLKSLGIKKGERIYTLSPRLPELYIGA
IGILKNLSVMCPLFSQFGPGPILQRMQSGDATALLTTQKLFNKKIRPMLNELKGLKYILL
IDAEEDENEIIRSLPKLMQEASDEFEIPPTDPEDMSLLHFTSGTTGMPKGVVHVHKAIYT
HWMTGKYVLDFHEHDNYWCTADPGWVTGTSYGIITPWVHGVTNIVDESEFNANRWYEILQ
NEKVSVFYTAPTAIRRLMRIDNEPTEEYDLSHLRLIQSVGEPLNPEAVIWGVEKLKMAIH
DNWWQTETGGIMIANLISQTVRPGSMGRPLPGITAAIVRQNGDGTVTEVTEPGKDGDLAL
RPGWPSMFRAYLHNEEKYKKSFVGGWYISGDLAYKDEDGYYWFVGRADDIIKTSGHMVGP
FEVESALMEHPAVAEAGVIGKPDELIGQLVKAFVSLKHGYEPTEELKRELIGFARKKLGA
AVAPKEIEFQEKLPKTRSGKIMRRLLKAREMGLPEGDTSTLEE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataattggattgtgaaaaagaaaagtgattttttagttgaaccgaatctttta
gattatgaaaaagtctataactcttttaaatgggaagatgtagcaaaagagtttgacggt
ttgccctcaggtggattaaacatcgctcatgaagcaattgaccggcatgctgattctgat
aaagccgataaagtggctttattatggcttggagagaaagggcagaaagtaagctataca
tatatgcagatgaaaaaagagacggcgaagtttgccaatgtattaaaatcattaggcatt
aaaaaaggggaaagaatttatacactttctccgagattgccggagctttacatcggagct
ataggtatacttaaaaacctgagcgtgatgtgtcctcttttctcacagtttggtcccggt
cctatactgcagcgtatgcaaagcggtgatgcgacggctcttctaacaacccaaaaactt
tttaataaaaaaatccgtccgatgctcaatgaacttaaagggttgaaatatatactttta
atagatgccgaggaagatgaaaatgagataatacgttcacttccaaaacttatgcaagag
gcttcggacgaatttgaaattcctccaactgatcctgaggatatgtcactgctgcacttt
acaagcggaacgacaggtatgccaaaaggtgtagttcacgtgcataaagcaatatataca
cactggatgacaggcaaatatgttcttgattttcatgagcatgataactactggtgtact
gccgatccgggttgggtaacggggacctcatacggaattattactccatgggtgcatggc
gtgactaatattgttgatgaatctgaatttaatgcaaacagatggtatgagatactgcaa
aatgaaaaagtcagtgttttttatacggcaccgacagccatacgacgtttgatgagaatc
gataatgaaccgactgaggagtatgacctttctcatctgcgccttattcaaagtgttggc
gaaccgctgaatcctgaagctgttatatggggtgttgaaaaactgaaaatggctatacat
gacaactggtggcagactgaaacaggcggcataatgatagcaaacctaatatctcaaaca
gtaagaccaggctcgatgggacggcctcttcccggaataactgcggcaatcgttcgtcaa
aatggggatggaacggtaacggaggtaacagagcctggaaaagatggagatttggctctt
agacccggctggccgtctatgtttagagcgtatctgcataatgaagaaaaatataaaaaa
tcttttgtcggtggatggtatatctcaggagacttggcttataaagatgaagacgggtat
tattggtttgtcggccgtgcagatgatattataaaaacatccggacacatggtaggtcct
tttgaggttgaaagcgccctgatggagcaccctgcggttgccgaagctggagttatcggt
aaaccggatgagcttatcggacagcttgtcaaggcttttgtgtctttaaaacacgggtat
gagccgacagaagaattaaaacgggaacttattggttttgcacgcaaaaagctaggtgca
gcagtagctccaaaagagatagagtttcaagaaaagcttcctaaaacccgtagcggcaag
attatgagaagactgttaaaagcaagagaaatgggattgcctgaaggtgatacttctacc
ttggaagagtaa

DBGET integrated database retrieval system