KEGG   Sulfurimonas autotrophica: Saut_0559Help
Entry
Saut_0559         CDS       T01316                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00010  Glycolysis / Gluconeogenesis
sua00020  Citrate cycle (TCA cycle)
sua00620  Pyruvate metabolism
sua01100  Metabolic pathways
sua01110  Biosynthesis of secondary metabolites
sua01120  Microbial metabolism in diverse environments
sua01130  Biosynthesis of antibiotics
sua01200  Carbon metabolism
Module
sua_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_0559
   00020 Citrate cycle (TCA cycle)
    Saut_0559
   00620 Pyruvate metabolism
    Saut_0559
Enzymes [BR:sua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Saut_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 PYNP_C E3_binding Peptidase_M23 ATP-synt_ab_Xtn DUF2118 QRPTase_N DUF3656 MICSWaP
Motif
Other DBs
NCBI-ProteinID: ADN08608
UniProt: E0UPL6
Position
539721..540878
Genome map
AA seq 385 aa AA seqDB search
MSTFVMPSLGADMESAVLMEWKVKEGDKVKKGDIIAEVETSKGVIEIEVFEDGIVEKLLV
EPETECKVGDPIALIHSDNENSSEKTEQKVSQKIPKIKEEIKKEISQVKEDSAEEKRIKI
SPAARKKAKELGVNLEELSSHIKGKIQLSDIEKAVKKTQNTSFSSDGMRQAIAKAMSRSN
AEIPHYYLSTSINMTPALQWLKELNAKRSINERILPAALMIRAVVSALKKVPELNGFWKD
NAPQISDAINPGIAIALRKSGLITPAILNTQQMNLDDVMKSLSDLITRTRSGKLKGSEMT
QQTVTITNLGDLGVESVLGVIYPPQVAIVGIGRIIDKPWAENDMLSVRKVVQVTLAGDHR
ATDGRTGAQFLDKLDKILQKPEELL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtacttttgtaatgccgagtctcggggcagatatggaatctgccgttttgatggag
tggaaagttaaagaaggagacaaagtaaaaaaaggcgatattattgccgaggttgaaaca
agcaagggtgttatagagatagaggtttttgaagacggaattgttgaaaagcttttggtt
gaacccgaaaccgagtgtaaggttggtgatccgattgctttgattcattctgataatgag
aattcatctgagaaaacagaacaaaaagtatctcagaaaatacctaaaataaaagaagaa
ataaaaaaagagatttcccaagttaaagaagattcagcagaggaaaaacgcataaaaatc
tcaccggcagcaagaaaaaaagctaaagaattgggtgttaatttagaggaactttcttct
catataaaaggtaaaattcagttaagtgatattgaaaaggccgtgaagaaaacccaaaat
acaagtttttcatcagacggcatgcgtcaggctattgccaaggcaatgagtcgttcaaat
gcagagataccgcattactatctctcaacttccataaatatgacaccggcacttcaatgg
cttaaagagttaaatgccaaacgcagcataaatgagcgtattttaccggctgcattgatg
ataagagctgtagtatcggcactaaaaaaagttccggagctcaatggtttttggaaagat
aatgctccgcaaatatccgatgcgataaatccaggtattgccatagcacttcgcaaaagc
ggtttgattacacctgctattttaaatacacagcaaatgaatctggatgacgttatgaaa
tctttaagtgatttaatcacccgtacacgctcaggtaaattaaaaggcagtgaaatgacg
caacagacagtcactataaccaatcttggagatttgggtgtagagagcgtactcggtgtt
atttatccccctcaagtcgctatagtaggcattggccgtataatagataagccttgggca
gagaatgatatgttaagtgttcgcaaggttgttcaagttacgcttgcaggtgatcatcgt
gcaacagatggccgtaccggagcacaattcttagacaagctggataaaattttacaaaaa
ccggaggagttgttatga

DBGET integrated database retrieval system