KEGG   Sulfurimonas autotrophica: Saut_0603Help
Entry
Saut_0603         CDS       T01316                                 

Definition
Protein-L-isoaspartate(D-aspartate)O-methyltrans ferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sua  Sulfurimonas autotrophica
Brite
Enzymes [BR:sua01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Saut_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(583220..583831)
Genome map
AA seq 203 aa AA seqDB search
MKTNKELIQSMQNSGVLKTPHIMEAFEKIDRKYFVPEGFEEEIYVDAPLPIGKGQTISQP
STVAFMLELLAPQEGDSILDIGSGSAWTTALLCAIVTETGNVIGMDRVDTLVEAGKKKLS
QFEFKHCHIEKAGDKLGKPGEQFDKILVSASAPEIPVELFEQLKIGATLVIPVVNSIFKF
KKLSDTKVQKEEYAGFVFVPLIY
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaataaagaacttattcaaagtatgcaaaattcaggggtattaaaaacacca
cacatcatggaagcttttgaaaaaattgacagaaaatattttgtgcctgaaggttttgaa
gaggaaatctatgtagatgcccccttaccgattggaaagggtcaaactatctcacagcca
tcaacagtagcctttatgcttgagctgcttgcaccccaagaaggcgactctatactcgat
atcggttcaggttcagcttggactacagccttattatgtgcaatcgtcacagaaaccggc
aacgtaataggaatggaccgggtcgatacacttgtagaagcaggaaaaaagaagctttca
cagtttgaatttaaacattgtcatatcgaaaaagcaggtgataaactcggaaagccgggg
gagcaatttgataaaattctagtctctgccagtgcacccgagatccctgttgagcttttt
gaacaacttaaaatcggtgcaacactggttatacctgtagtgaactctatttttaagttt
aaaaaactttcagatacgaaagtgcaaaaagaagaatatgcaggatttgtatttgtgccg
ctgatttactaa

DBGET integrated database retrieval system