KEGG   Sulfurimonas autotrophica: Saut_0647Help
Entry
Saut_0647         CDS       T01316                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sua  Sulfurimonas autotrophica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_0647
   00030 Pentose phosphate pathway
    Saut_0647
   00051 Fructose and mannose metabolism
    Saut_0647
   00052 Galactose metabolism
    Saut_0647
   00500 Starch and sucrose metabolism
    Saut_0647
   00520 Amino sugar and nucleotide sugar metabolism
    Saut_0647
  Nucleotide metabolism
   00230 Purine metabolism
    Saut_0647
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Saut_0647
Enzymes [BR:sua01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Saut_0647
    5.4.2.8  phosphomannomutase
     Saut_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627211..628581
Genome map
AA seq 456 aa AA seqDB search
MSIYREYDIRGIYEKELNEESVTKIGFALSSKIDGEFVAVGYDARSHSPILFEYLVKGLN
AGGKKVLDMGLVPTPVNYFTNYQEWAVENQMITPSASVMITGSHNPSEYNGFKITVDKSP
FFGEDIYALGRECATLDMPKPAPRDVTKINAKERYIDFLVNEFQHLKGMDTKIVYDCGNG
VGGVVLPEIFEKLELNTKGLYIEPDGTFPNHHPDPSVEENLQDVKELLEKEGDIAFAYDG
DADRIAVLTHKNNIKGDMLALLFAMKMDKPTIVGEVKCSQVMYDELERRGAKAVMYKTGH
SNLKVKMKEIDADLACEVSGHIFFKNRYFGYDDAIYATLRVLELIKDGIDLDAELAKLPK
VYSTEEIKVETTENEKFKIIDKVKELLQNPPSDFPAIKDIIDVDGVRINFEKGWGLVRAS
NTTPVLVTRFESTAEKEAKHYEKAINDLIVKAKESL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatttatagagaatacgacatacgtggaatatacgaaaaagaattaaatgaagaa
agtgtcacgaaaataggatttgcactttcctctaaaatagatggtgaatttgtcgctgta
ggctatgatgcaagaagtcactcaccgattctttttgaatatttggtaaaaggtcttaat
gccggcgggaaaaaagtgcttgatatggggcttgttccgactcctgtaaattactttaca
aattatcaggaatgggcagtagaaaatcaaatgattacaccgtctgcttcggtgatgata
actggctcacataatccaagtgaatacaacggttttaaaatcacagtagacaaatctcca
ttttttggtgaagatatttatgcgcttggacgtgagtgcgcaactttggatatgccaaaa
cctgcaccaagagatgtgacaaaaataaatgcaaaagagcgatacatagactttttggta
aatgaatttcaacatctcaaaggcatggacactaaaatagtatatgactgtgggaacggc
gtaggcggtgtggttcttccagagatttttgagaagttagaacttaatacaaaagggctc
tatattgaaccagatggaactttcccaaatcatcatcccgatccttctgtagaagaaaat
ttacaagatgtaaaagagctgcttgaaaaagagggagacattgcttttgcctatgacggt
gatgcagaccgcatagccgttcttacacacaaaaataacattaaaggcgatatgctcgct
cttttgtttgctatgaaaatggataaaccgaccattgtcggagaggtaaaatgctcacag
gtgatgtatgatgaacttgagcgtcgcggtgccaaagctgttatgtataaaacagggcac
tcaaacctaaaagtaaaaatgaaagagatagatgcagatttggcttgtgaagtcagtggg
catattttctttaaaaaccgttacttcgggtatgacgatgctatttatgcgacgctcaga
gtacttgaacttataaaagacggtatagatttagatgcagaacttgccaaactgccaaaa
gtttattctaccgaagagataaaagtagagactactgagaacgagaaatttaaaattatc
gacaaggtaaaagaactgcttcaaaatccaccatcagattttcctgccatcaaagatatc
atagacgtggacggtgtgcgtataaactttgaaaaaggctggggtcttgtacgggcaagt
aacacgacacctgttttagttacacgctttgagtcaacagcagaaaaagaagcaaaacat
tatgaaaaagcaataaatgatttaatagtaaaagcaaaagaaagtttataa

DBGET integrated database retrieval system